Recombinant Shigella boydii serotype 18 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
frdC; SbBS512_E4684; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit C anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase subunit C (frdC) and what is its role in Shigella boydii?

Fumarate reductase subunit C (frdC) is a 15 kDa hydrophobic protein component of the fumarate reductase enzyme complex in Shigella boydii serotype 18. This protein, identified by the UniProt accession number B2TY30, plays an essential role in anaerobic respiration by allowing the bacterium to use fumarate as a terminal electron acceptor when oxygen is unavailable. The full amino acid sequence consists of 131 amino acids: MTTKRKPYVRMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW .

The frdC gene (locus name SbBS512_E4684) encodes this protein in Shigella boydii serotype 18 (strain CDC 3083-94 / BS512). As part of the fumarate reductase complex, frdC is typically associated with the bacterial membrane and contributes to energy metabolism under low-oxygen conditions, a situation frequently encountered by enteric pathogens like Shigella during host colonization. This adaptation allows the bacterium to maintain energy production in the anaerobic environment of the intestinal tract, which is crucial for its pathogenicity and survival.

How does frdC differ structurally and functionally from other components of the fumarate reductase complex?

Fumarate reductase typically consists of four subunits (A, B, C, and D), with frdC being one of the membrane-anchoring components. While the catalytic activity primarily resides in subunits A and B, the C subunit plays a crucial structural role in membrane anchoring and electron transport chain integration. The frdC in Shigella boydii serotype 18 shows characteristic features of membrane proteins, including multiple hydrophobic regions that facilitate its integration into the bacterial membrane.

Compared to the A and B subunits, which contain the catalytic site and electron transfer components (flavin adenine dinucleotide and iron-sulfur clusters), frdC lacks direct catalytic function but is essential for the proper positioning of the complex in the membrane. This structural role is critical because it ensures that electron transfer can occur efficiently between the cytoplasmic electron donors and the terminal electron acceptor fumarate. Research in related bacteria has shown that fumarate reductase components, including frdC, significantly contribute to reactive oxygen species (ROS) formation when these anaerobic or facultative anaerobic bacteria are exposed to oxygen .

What evolutionary significance does frdC hold in the context of bacterial adaptation to different oxygen environments?

The conservation of frdC across diverse bacterial species underscores its evolutionary importance in adaptation to varying oxygen conditions. In facultative anaerobes like Shigella boydii, the ability to switch between aerobic and anaerobic metabolism provides a significant survival advantage when transitioning between oxygen-rich and oxygen-limited environments. The fumarate reductase complex, including frdC, represents a key adaptation that enables this metabolic flexibility.

Interestingly, while frdC is essential for anaerobic growth, research has revealed its unexpected contribution to oxidative stress when bacteria transition to aerobic conditions. Studies in Bacteroides fragilis have demonstrated that deletion of frdC increases aerotolerance in strains lacking superoxide dismutase, indicating that fumarate reductase contributes significantly to ROS formation upon oxygen exposure . This dual role - enabling anaerobic respiration while potentially contributing to oxidative stress during aerobiosis - reflects the complex evolutionary trade-offs in bacterial adaptation to fluctuating environments.

The conservation of the protein structure across different bacterial species, along with species-specific variations, suggests that frdC has evolved to optimize function within particular ecological niches. This evolutionary perspective on frdC provides valuable context for understanding bacterial metabolism and potential targets for antimicrobial development.

What are the recommended expression and purification methods for recombinant Shigella boydii frdC?

Successful expression and purification of recombinant Shigella boydii frdC requires specialized approaches due to its hydrophobic nature and membrane localization. Based on current methodologies for similar membrane proteins, researchers should consider the following strategies:

For expression systems, E. coli strains specifically designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results than standard laboratory strains. These specialized strains can accommodate the potentially toxic effects of membrane protein overexpression. Expression should be conducted at lower temperatures (typically 18-25°C) with reduced inducer concentrations to minimize inclusion body formation and protein aggregation.

The purification protocol should include:

  • Gentle membrane solubilization using appropriate detergents (DDM, LMNG, or OG are commonly effective for membrane proteins)

  • Affinity chromatography utilizing fusion tags determined during the design process

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Buffer optimization containing 50% glycerol for stability

For structural and functional studies, consider reconstitution into nanodiscs or liposomes to provide a native-like membrane environment. The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for extended storage, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles that can compromise protein integrity .

How can researchers effectively design genetic knockout studies to investigate frdC function?

Designing effective genetic knockout studies for frdC investigation requires strategic approaches to both gene deletion and phenotypic analysis. Based on established methodologies for similar studies in related bacteria, researchers should consider:

For creating frdC deletion mutants:

  • Two-step double-crossover technique: This approach has been successfully used in Bacteroides fragilis studies . It involves creating a deletion construct with N-terminal and C-terminal fragments of the gene, ligating them into a suicide plasmid, and selecting for recombinants that have undergone two crossover events to replace the wild-type gene with the deletion construct.

  • RED recombination system: As demonstrated in studies with Shigella, this phage lambda-based system can effectively replace target genes with selectable markers . The technique involves PCR amplification of a resistance marker (such as chloramphenicol acetyltransferase) with primers carrying homology to regions flanking the frdC gene.

For phenotypic analysis of knockout mutants:

  • ROS detection assays: Since frdC has been implicated in ROS generation, techniques such as Amplex Red with horseradish peroxidase provide sensitive methods for H₂O₂ detection . These assays should be performed under controlled oxygen conditions.

  • Aerotolerance testing: Measuring survival rates in the presence of oxygen can reveal the role of frdC in oxidative stress, particularly in backgrounds where other protective mechanisms (like superoxide dismutase) have been eliminated .

  • Metabolic profiling: Analyzing changes in central carbon metabolism, particularly TCA cycle intermediates, can provide insights into the metabolic consequences of frdC deletion.

Complementation studies, where the wild-type frdC gene is reintroduced into the knockout strain, are essential to confirm that observed phenotypes are directly attributable to frdC deletion rather than polar effects or secondary mutations.

What techniques are most effective for studying the contribution of frdC to reactive oxygen species (ROS) generation?

Investigating frdC's contribution to ROS generation requires specialized techniques that can detect, quantify, and characterize reactive oxygen species under controlled conditions. Based on successful approaches in related research, the following methodologies are recommended:

  • Genetic background optimization: As demonstrated in Bacteroides fragilis studies, deletion of major ROS-scavenging enzymes (catalase, alkylhydroperoxide reductase, and thioredoxin-dependent peroxidase) enhances the ability to detect and quantify ROS production attributable to fumarate reductase activity . Creating similar compound mutants in Shigella (ΔahpCΔkatΔtpx background) provides a sensitized system for studying frdC-dependent ROS generation.

  • Quantitative H₂O₂ detection: The Amplex Red/horseradish peroxidase system offers high sensitivity for H₂O₂ measurement . This fluorometric assay can detect nanomolar concentrations of H₂O₂ in bacterial cultures or cell-free systems.

  • Oxygen transition experiments: Since frdC's contribution to ROS generation is most pronounced during transitions from anaerobic to aerobic conditions, experiments should be designed with precise oxygen control. This can be achieved using:

    • Hungate tubes for anaerobic sampling

    • Pre-reduced media and buffers

    • Anaerobic chambers for sample preparation

  • Manipulation of fumarate availability: Exogenous fumarate supplementation significantly affects H₂O₂ production in bacterial strains with compromised ROS-scavenging abilities . Experiments should include conditions with varying fumarate concentrations to assess its impact on ROS generation.

  • Membrane fraction isolation: Since frdC is membrane-localized, separating membrane fractions can help determine whether ROS generation occurs directly at the membrane or through secondary mechanisms.

These approaches, combined with appropriate controls and careful experimental design, can provide robust insights into the mechanistic role of frdC in ROS generation during oxygen exposure.

How does the molecular mechanism of frdC contribute to ROS formation during oxygen exposure?

The molecular mechanism by which frdC contributes to ROS formation represents a fascinating intersection of anaerobic and aerobic metabolism. Based on current research, the following model explains this phenomenon:

This hypothesis is supported by observations in Bacteroides fragilis, where exogenous fumarate significantly reduced H₂O₂ production in strains lacking major ROS-detoxifying enzymes . This suggests that providing adequate amounts of the proper electron acceptor (fumarate) completes the intended electron transfer pathway, reducing electron leakage to oxygen.

The transmembrane domains of frdC likely play a critical role in this process by anchoring the complex at the membrane-cytoplasm interface where it can interact with both cytoplasmic electron donors and the membrane electron transport chain. When frdC is deleted, this membrane association is disrupted, potentially explaining the observed increase in aerotolerance in superoxide dismutase-deficient strains .

What structural features of frdC determine its role in membrane anchoring versus electron transport?

The dual functionality of frdC in membrane anchoring and potential contribution to electron transport pathways is determined by specific structural features within its 131-amino acid sequence. Analysis of this sequence reveals:

  • Transmembrane domains: The frdC protein contains multiple hydrophobic regions that form transmembrane helices, as evidenced by its amino acid sequence (MTTKRKPYVRMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW) . These hydrophobic stretches allow the protein to integrate stably into the bacterial membrane.

  • Charged residues: Strategically positioned charged amino acids (particularly lysine and arginine residues) likely facilitate interactions with the hydrophilic components of the fumarate reductase complex and may participate in proton transport processes.

  • Conserved motifs: Comparison with other bacterial frdC proteins reveals conserved regions essential for proper interaction with the catalytic subunits (frdA and frdB).

The transmembrane orientation of frdC positions it perfectly to serve as both an anchor for the catalytic components and a conduit for electron transfer. The specific arrangement of hydrophobic and hydrophilic domains creates a microenvironment that can influence electron flow and potentially contribute to electron leakage to oxygen when the system is exposed to aerobic conditions.

Advanced structural studies using techniques like cryo-electron microscopy or X-ray crystallography would provide deeper insights into these structure-function relationships, particularly regarding how specific amino acid residues might contribute to electron transfer versus membrane anchoring functions.

How can systems biology approaches integrate frdC function into broader metabolic networks?

Systems biology approaches offer powerful frameworks for understanding how frdC function integrates into broader metabolic networks in Shigella boydii. These approaches can reveal emergent properties not evident from studying isolated components:

These integrated approaches move beyond reductionist views of frdC function to understand its role within the complex, adaptive metabolic network of the bacterial cell.

What are common challenges in studying frdC function and how can they be addressed?

Studying frdC function presents several technical challenges that researchers should anticipate and address:

  • Membrane protein expression difficulties:

    • Challenge: Low expression yields and protein aggregation are common with membrane proteins like frdC.

    • Solution: Use specialized expression strains designed for membrane proteins, lower induction temperatures (18-25°C), optimize codon usage, and consider fusion tags that enhance solubility without compromising function.

  • Maintaining native conformation during purification:

    • Challenge: Detergent extraction can disrupt native protein folding and function.

    • Solution: Screen multiple detergents and lipid compositions, consider nanodiscs or liposomes for reconstitution, and include stabilizing agents like glycerol (50%) in storage buffers .

  • Oxygen sensitivity during experiments:

    • Challenge: Studying an anaerobic enzyme under controlled oxygen conditions requires specialized equipment.

    • Solution: Use anaerobic chambers for sample preparation, pre-reduced buffers, sealed Hungate tubes for anaerobic sampling, and rapid processing protocols to minimize exposure to air .

  • Separating direct and indirect effects in knockout studies:

    • Challenge: Distinguishing primary effects of frdC deletion from secondary metabolic adaptations.

    • Solution: Perform time-course experiments immediately after gene deletion or induction, use complementation studies with wild-type frdC, and compare with phenotypes of other respiratory chain component deletions.

  • ROS detection specificity:

    • Challenge: Ensuring that detected ROS are specifically related to frdC function.

    • Solution: Use multiple ROS detection methods, include appropriate controls with ROS scavengers, and perform experiments in genetic backgrounds with defined ROS scavenging capabilities (like the ΔahpCΔkatΔtpx background used in B. fragilis studies) .

Addressing these challenges requires careful experimental design and often the integration of multiple complementary approaches to build a coherent understanding of frdC function.

How can researchers distinguish between frdC effects on ROS generation versus other metabolic functions?

Distinguishing between frdC's role in ROS generation and its other metabolic functions requires experimental designs that can separate these overlapping effects:

  • Genetic approach using point mutations:

    • Create targeted mutations in frdC that specifically affect membrane anchoring versus potential electron leakage sites

    • Compare phenotypes of these mutants to identify which functions correlate with which structural features

  • Controlled oxygen transition experiments:

    • Monitor metabolic parameters simultaneously with ROS formation during transitions from anaerobic to aerobic conditions

    • Use defined oxygen concentrations to establish dose-response relationships for both ROS generation and metabolic shifts

  • Metabolic flux analysis with stable isotopes:

    • Trace carbon flow through central metabolism using 13C-labeled substrates in wild-type and frdC mutant strains

    • Quantify how frdC deletion affects flux distribution independent of ROS effects

  • Temporal separation of effects:

    • ROS generation typically occurs rapidly upon oxygen exposure

    • Metabolic adaptations generally require more time for gene expression changes

    • Time-course experiments can help distinguish immediate (likely ROS-related) from delayed (likely metabolic adaptation) effects

  • Experimental matrix design:

    • Combine frdC manipulation with alterations in:

      • Fumarate availability (affects electron acceptor function)

      • ROS scavenging capabilities (affects detection sensitivity)

      • Electron donor availability (affects electron flow through the complex)

    • The pattern of responses across this matrix can reveal which functions are mechanistically linked

  • In vitro reconstitution:

    • Purify components and reconstitute activities in defined systems

    • Control redox partners, substrate concentrations, and oxygen levels precisely

    • Measure direct electron transfer to oxygen versus fumarate under various conditions

This multifaceted approach can help deconvolute the complex roles of frdC in both anaerobic energy metabolism and oxygen-related ROS generation.

What are the critical controls needed in experimental designs studying frdC function?

Robust experimental design for studying frdC function requires careful implementation of appropriate controls to ensure valid interpretation of results:

  • Genetic controls:

    • Wild-type strain (positive control for normal function)

    • Clean frdC deletion mutant (test strain)

    • Complemented strain (frdC deletion with plasmid-expressed wild-type frdC) to confirm phenotype reversal

    • Deletions of other fumarate reductase subunits (to distinguish frdC-specific from complex-general effects)

    • Deletions in unrelated membrane proteins (to control for general membrane disruption effects)

  • Environmental controls:

    • Strictly anaerobic conditions (baseline for fumarate reductase natural function)

    • Defined oxygen concentrations (to establish dose-response relationships)

    • Controlled transitions between anaerobic and aerobic conditions (timing and rate)

    • Media composition controls (particularly fumarate concentration, which significantly affects H₂O₂ production)

  • Methodological controls for ROS detection:

    • Enzyme-free reactions (reagent background)

    • Heat-inactivated samples (to control for non-enzymatic ROS generation)

    • Known concentrations of H₂O₂ for standard curves

    • Inclusion of ROS scavengers like catalase (to confirm specificity of detection methods)

    • Multiple detection methods (Amplex Red/HRP, EPR spin trapping, fluorescent probes) to corroborate results

  • Protein expression and purification controls:

    • Empty vector controls for expression studies

    • Membrane fraction from non-expressing cells (background control)

    • Purification of unrelated membrane protein using identical conditions (methodology control)

    • Activity assays with known substrates and inhibitors to confirm functional integrity

  • Systems biology controls:

    • Samples for multi-omics analyses processed in parallel

    • Time-matched controls for dynamic studies

    • Biological replicates (typically triplicate) for statistical validation

    • Technical replicates to assess methodological variation

Implementation of this comprehensive control strategy ensures that observed phenotypes can be confidently attributed to specific aspects of frdC function rather than experimental artifacts or secondary effects.

How might frdC research contribute to novel antimicrobial development strategies?

Research on frdC holds promising potential for antimicrobial development through several innovative strategies:

  • Targeting anaerobic metabolism in infection sites:

    • Many infection sites (abscesses, biofilms, intestinal lumen) are oxygen-limited environments where bacteria rely on anaerobic respiration

    • Compounds specifically inhibiting fumarate reductase could disrupt energy production in these niches

    • The unique structure of frdC and its essential role in complex assembly makes it a potential specific target

  • Exploiting ROS generation for bacterial sensitization:

    • The observed role of fumarate reductase in ROS generation suggests a novel strategy: compounds that enhance this activity could increase oxidative stress in pathogens

    • This approach could be particularly effective against anaerobic pathogens transitioning to aerobic environments during infection spread

    • Such compounds might synergize with the host immune response, which often utilizes oxidative killing mechanisms

  • Combination therapy approaches:

    • frdC inhibitors could sensitize bacteria to conventional antibiotics by disrupting energy metabolism

    • The increased aerotolerance observed in frdC deletion strains lacking superoxide dismutase suggests complex interactions between respiratory chains and stress responses that could be exploited

  • CRISPR-based antimicrobials:

    • The rise of CRISPR technology for bacterial targeting could be applied to specifically target frdC or related genes

    • As noted in recent patent information, antibiotic resistance has been identified as "one of the greatest global health challenges" , making targeted approaches increasingly valuable

  • Structure-based drug design:

    • Detailed structural characterization of frdC and its interactions within the fumarate reductase complex could enable rational design of specific inhibitors

    • Targeting the membrane-anchoring function specifically might disrupt complex assembly without directly affecting catalytic activity, potentially reducing selection pressure for resistance

These approaches represent promising avenues for addressing the growing challenge of antibiotic resistance through mechanism-based targeting of bacterial energy metabolism.

What emerging technologies could advance our understanding of frdC structure and function?

Emerging technologies across multiple scientific disciplines offer exciting opportunities to deepen our understanding of frdC structure and function:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy (cryo-EM) with improved resolution can reveal the structure of membrane proteins like frdC in near-native environments

    • Microcrystal electron diffraction (MicroED) allows structural determination from very small crystals, potentially overcoming traditional crystallization barriers for membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into protein dynamics and conformational changes upon substrate binding or protein-protein interactions

  • Single-molecule approaches:

    • Single-molecule FRET to study conformational dynamics of frdC in real-time

    • Nano-scale thermophoresis for precise measurement of binding interactions

    • Atomic force microscopy to visualize membrane integration and complex assembly

  • Advanced genetic tools:

    • CRISPR interference (CRISPRi) for tunable repression rather than complete knockout

    • Genetic code expansion to incorporate non-canonical amino acids for site-specific probing

    • Optogenetic tools for temporal control of frdC expression or activity

  • Systems-level approaches:

    • Multi-scale modeling integrating atomic-level simulations with metabolic network models

    • Machine learning algorithms to identify patterns in multi-omics data from frdC mutants

    • High-throughput phenotyping under varied environmental conditions

  • Innovative biochemical methods:

    • Native mass spectrometry of membrane complexes to determine stoichiometry and interaction partners

    • Nanodiscs and lipid cubic phase technologies for improved membrane protein handling

    • Time-resolved spectroscopy to capture transient states during electron transfer

  • Cellular imaging advances:

    • Super-resolution microscopy to visualize the distribution and dynamics of frdC in bacterial membranes

    • Correlative light and electron microscopy to connect functional states with structural arrangements

    • Redox-sensitive fluorescent probes to visualize ROS generation in real-time

These technologies, especially when applied in combination, promise to overcome traditional barriers in membrane protein research and provide unprecedented insights into how frdC contributes to bacterial metabolism and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.