Recombinant Shigella boydii serotype 18 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Fumarate reductase (Frd) is a membrane-bound enzyme in Shigella species, enabling energy production under anaerobic conditions. The frdD subunit (UniProt: B2TY29) is a 13 kDa hydrophobic protein essential for stabilizing the enzyme’s structure and function. Recombinant frdD is produced in heterologous systems (e.g., E. coli, yeast) to study its role in bacterial metabolism and as a tool for vaccine development .

Applications in Research and Vaccine Development

While frdD’s primary role is in bacterial energy metabolism, its recombinant form has emerged as a candidate for:

  • Vaccine Antigen: frdD’s surface localization and immunogenic potential make it a target for subunit vaccine development .

  • Diagnostic Tools: Used in ELISA assays to detect anti-Shigella antibodies .

  • Structural Studies: His-tagged versions facilitate crystallographic or NMR-based analysis of enzyme dynamics .

Challenges and Future Directions

  • Stability: Recombinant frdD requires optimized storage conditions due to glycerol-dependent stabilization .

  • Vaccine Efficacy: Limited data exist on frdD’s protective efficacy in animal models or human trials, highlighting the need for further immunogenicity studies .

  • Antimicrobial Targets: frdD’s role in anaerobic respiration positions it as a potential target for novel antibiotics, though no inhibitors are currently reported .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
frdD; SbBS512_E4683; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
frdD
Target Protein Sequence
MINPNPKHSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit D anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase subunit D in Shigella boydii metabolism?

Fumarate reductase subunit D (frdD) functions as the membrane anchor protein for the fumarate reductase complex in Shigella boydii. This complex catalyzes the reduction of fumarate to succinate during anaerobic respiration, allowing the bacterium to use fumarate as a terminal electron acceptor when oxygen is unavailable. The frdD protein in Shigella boydii serotype 18 consists of 119 amino acids with a highly hydrophobic profile that facilitates its integration into the bacterial membrane .

From a methodological perspective, researchers studying frdD's role should implement anaerobic growth experiments comparing wild-type and frdD knockout strains to quantify the contribution of this protein to bacterial survival under oxygen-limited conditions that mimic intestinal environments during infection.

How does frdD structure compare across Shigella species?

While the search results don't provide direct comparative analyses of frdD across all Shigella species, genomic analyses reveal significant diversity among Shigella species. S. boydii exhibits the greatest genomic diversity (24.2 SNPs per kbp), followed by S. flexneri (19.5 SNPs per kbp) and S. dysenteriae (11.8 SNPs per kbp), with S. sonnei showing the least diversity .

To investigate structural variations, researchers should employ comparative genomics approaches with multiple sequence alignments of frdD sequences from different Shigella species, focusing on identifying conserved domains versus variable regions. Hydrophobicity analyses and transmembrane prediction algorithms should be applied to determine if structural features are maintained despite sequence variations.

What experimental systems can confirm frdD functionality?

To validate frdD function, researchers should develop multi-component experimental systems that reconstruct the complete fumarate reductase complex. This requires:

  • Reconstitution assays: Incorporating purified recombinant frdD along with other fumarate reductase subunits into liposomes or nanodiscs to create a functional complex.

  • Enzymatic activity measurements: Using spectrophotometric assays to monitor fumarate reduction by tracking the oxidation of reduced quinones (electron donors) in the reconstituted system.

  • Complementation studies: Expressing recombinant frdD in frdD-deficient bacterial strains to confirm restoration of anaerobic growth capabilities.

  • Membrane integration verification: Using protease protection assays to confirm proper orientation of frdD in membrane preparations.

These approaches provide more meaningful functional data than simple binding studies, as they test the actual biological activity of the protein in a near-native environment.

What expression systems are optimal for producing recombinant frdD?

As a highly hydrophobic membrane protein, frdD presents significant expression challenges requiring specialized approaches:

  • E. coli specialized strains: C41(DE3) or C43(DE3) strains engineered specifically for membrane protein expression provide better yields than standard BL21 strains. These strains contain mutations that prevent membrane protein toxicity.

  • Expression parameters: Critical factors include:

    • Induction at lower temperatures (16-20°C)

    • Reduced inducer concentrations (0.1-0.5 mM IPTG)

    • Extended expression periods (16-24 hours)

    • Addition of membrane stabilizers to growth media

  • Fusion strategies: N-terminal fusions with highly soluble partners like MBP or SUMO can improve expression while including a protease cleavage site for tag removal.

The commercially available recombinant frdD is stored in a Tris-based buffer with 50% glycerol , suggesting successful expression has been achieved with appropriate stabilization strategies.

How can researchers optimize the purification of recombinant frdD?

Purifying membrane proteins like frdD requires specialized approaches:

  • Membrane extraction optimization:

    • Test a panel of detergents (DDM, LDAO, OG, LMNG) for efficient solubilization

    • Determine optimal detergent-to-protein ratios by systematic screening

    • Include stabilizing additives like glycerol (20-50%) and specific lipids

  • Purification workflow:

    • Affinity chromatography using His-tag or other fusion tags

    • Size exclusion chromatography to remove aggregates

    • Validation of monodispersity using dynamic light scattering

  • Quality control checkpoints:

    • SDS-PAGE to confirm purity

    • Western blotting for identity verification

    • Thermostability assays to assess proper folding

For frdD specifically, researchers should monitor detergent concentration throughout purification to prevent protein aggregation, as the hydrophobic nature of this protein (containing multiple transmembrane regions) makes it susceptible to precipitation when detergent concentration drops below critical micelle concentration.

What analytical methods can verify proper folding of recombinant frdD?

Verifying proper folding of membrane proteins like frdD requires multiple complementary techniques:

  • Circular dichroism spectroscopy: Can confirm secondary structure composition, particularly important for alpha-helical membrane proteins like frdD.

  • Differential scanning fluorimetry: Using fluorescent dyes that bind to exposed hydrophobic regions to monitor thermal unfolding curves.

  • Limited proteolysis: Properly folded membrane proteins show distinct proteolytic patterns compared to misfolded variants.

  • Structural homogeneity assessment: SEC-MALS (size exclusion chromatography with multi-angle light scattering) to verify monodispersity and absence of aggregation.

These methods should be applied to both freshly purified protein and samples stored under different conditions to establish optimal handling procedures for maintaining structural integrity.

How can recombinant frdD be used in Shigella immunology studies?

Recombinant frdD offers several valuable applications in immunological research:

  • Antibody development and validation:

    • Generation of polyclonal or monoclonal antibodies against frdD

    • Immunolocalization studies to visualize frdD distribution in bacterial cells

    • Western blot assays to detect frdD expression under different growth conditions

  • T-cell response characterization:

    • Stimulation of peripheral blood mononuclear cells (PBMCs) with purified frdD

    • Measurement of T-cell activation markers (CD25, CD38, HLA-DR, CD54)

    • Analysis of cytokine production profiles, particularly IFN-γ

Studies on Shigella immune responses have demonstrated that infection elicits both humoral and cell-mediated immunity, with increased proportions of memory T cells (CD45RO+) and expansion of defined T-cell receptor Vβ families in shigellosis patients . Similar methodological approaches could be applied specifically to investigate immune responses to frdD.

What approaches can reveal frdD's role in Shigella pathogenesis?

While direct evidence linking frdD to Shigella pathogenesis is limited in the search results, researchers can employ several methodologies:

  • Gene knockout studies with comprehensive readouts:

    • Create precise frdD deletion mutants using CRISPR-Cas9

    • Perform complementation with wildtype or modified frdD

    • Assess multiple phenotypes: growth under anaerobic conditions, epithelial cell invasion, macrophage survival, and in vivo colonization

  • Transcriptional regulation analysis:

    • Identify environmental signals that regulate frdD expression

    • Determine if frdD is co-regulated with established virulence factors

    • Use reporter constructs to visualize frdD expression during infection

  • Host-pathogen interaction studies:

    • Investigate whether frdD expression changes upon host cell contact

    • Determine if host immune responses specifically target frdD

    • Assess competitive fitness of wildtype versus frdD mutants in animal models

These approaches extend beyond simple expression studies to establish causal relationships between frdD function and Shigella virulence phenotypes.

How does frdD compare to homologs in vaccine development strategies?

While frdD itself is not prominently featured in vaccine development strategies, methodological insights can be gained from Shigella vaccine research approaches:

  • Antigen presentation contexts:

    • Recombinant carrier systems similar to those used for Shigella O-PS antigens

    • Live attenuated vaccine strains with modified frdD expression

    • Multicomponent subunit vaccines incorporating metabolic proteins

The development of Shigella vaccines has included approaches like transferring the virulence plasmid of S. sonnei to attenuated Salmonella enterica serovar Typhi strain Ty21a, resulting in hybrid vaccine strain 5076-1C that expressed S. sonnei O antigen . Similar methodologies could be explored for presenting metabolic antigens like frdD in vaccine contexts.

Table 1: Comparison of immune responses to wild-type Shigella flexneri 2a and potential applications to frdD-based approaches

ParameterWild-type S. flexneri responsePotential frdD-based approach
IgA anti-O-antigen ASC response92-100% responders Measure IgA anti-frdD ASC response using ELISPOT assays
Mean ASC per 10^6 PBMC71-239 Compare magnitude of anti-frdD response to established antigens
T-cell activationIncreased CD25, CD38, HLA-DR Quantify T-cell activation markers after frdD stimulation
Cytokine profileIFN-γ and IL-10 production Characterize cytokine patterns in response to frdD

How might frdD contribute to metabolic adaptations during host infection?

Advanced research into frdD's role in Shigella's metabolic adaptations should consider:

  • Metabolic network integration analysis:

    • Genome-scale metabolic modeling to predict flux through fumarate reductase under varying oxygen tensions

    • Isotope labeling experiments to trace carbon flow through central metabolism in wildtype versus frdD mutants

    • Identification of metabolic adaptations that compensate for frdD deletion

  • Spatial metabolism during infection:

    • Development of fluorescent biosensors to monitor fumarate/succinate ratios in infected tissues

    • Single-cell RNA sequencing to identify heterogeneity in frdD expression within bacterial populations during infection

    • Tissue-specific analysis of metabolite availability that might dictate frdD utilization

  • Host-pathogen metabolic competition:

    • Investigation of whether fumarate reductase activity provides competitive advantages against the intestinal microbiome

    • Analysis of how host-derived inflammatory metabolites influence frdD expression

    • Development of mathematical models predicting competitive outcomes based on metabolic capabilities

These approaches go beyond conventional gene expression studies to elucidate the functional significance of frdD in the complex metabolic landscape of infection.

What genomic variation patterns in frdD exist across clinical Shigella isolates?

Considering that S. boydii shows the highest genomic diversity among Shigella species (24.2 SNPs per kbp) , researchers should implement:

  • Population genomics approaches:

    • Comprehensive sequence analysis of frdD across diverse clinical isolates

    • Identification of single nucleotide polymorphisms, insertions, deletions, and recombination events

    • Calculation of selection pressures (dN/dS ratios) to identify signatures of positive selection

  • Structure-function correlation studies:

    • Mapping of genomic variations onto protein structural models

    • Functional testing of variants representing major frdD haplotypes

    • Development of high-throughput assays to assess functional consequences of variation

  • Epidemiological correlations:

    • Association studies linking specific frdD variants with disease severity or geographical distribution

    • Temporal analyses to track evolution of frdD in response to selective pressures

    • Integration with whole-genome sequence data to identify co-evolving genes

These approaches provide a multidimensional view of how genomic variation in frdD might influence Shigella adaptation to different host environments and geographical regions.

How can structural biology approaches inform frdD function and interactions?

Advanced structural biology approaches applicable to frdD research include:

  • Integrative structural determination:

    • Cryo-electron microscopy of the complete fumarate reductase complex

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Cross-linking mass spectrometry to map protein-protein interactions

    • Molecular dynamics simulations to predict conformational changes during catalysis

  • Membrane protein-specific techniques:

    • Solid-state NMR to study frdD in a lipid bilayer environment

    • Electron paramagnetic resonance spectroscopy with site-directed spin labeling

    • Native mass spectrometry of intact membrane protein complexes

    • Atomic force microscopy to visualize topography of membrane-embedded complexes

  • Structure-guided functional studies:

    • Systematic mutagenesis of predicted quinone-binding sites

    • Chimeric protein construction swapping domains between species variants

    • Computational prediction and experimental validation of allosteric sites

These approaches overcome limitations of traditional structural biology methods for membrane proteins and provide mechanistic insights into frdD function within the fumarate reductase complex.

What storage conditions maintain recombinant frdD stability?

Based on the commercial recombinant frdD preparation information, researchers should implement the following scientifically-validated storage protocols:

  • Primary storage conditions:

    • Store stock preparations at -20°C for routine use, or at -80°C for extended storage

    • Maintain in Tris-based buffer containing 50% glycerol to prevent freeze-thaw damage

    • Avoid repeated freeze-thaw cycles by preparing working aliquots

  • Working stock handling:

    • Keep working aliquots at 4°C for maximum of one week

    • Monitor protein integrity before experimental use

    • Add membrane-mimetic components (detergents, lipids) to maintain native conformation

  • Stability monitoring protocols:

    • Implement regular quality control testing including SDS-PAGE

    • Develop activity assays to confirm functional integrity

    • Use analytical techniques (e.g., dynamic light scattering) to detect aggregation

These approaches extend beyond simple storage recommendations to establish comprehensive stability monitoring systems essential for reproducible research with membrane proteins.

What controls are essential for frdD functional assays?

Rigorous experimental design for frdD functional studies requires comprehensive controls:

  • Positive controls:

    • Native membrane preparations containing functional fumarate reductase complex

    • Reconstituted systems with known activity levels

    • Previously characterized batches of recombinant protein

  • Negative controls:

    • Heat-denatured frdD preparations

    • Structurally similar but functionally distinct membrane proteins

    • Buffer-only controls incorporating all detergents and additives

  • Specificity controls:

    • Site-directed mutants with alterations in predicted functional regions

    • Competition assays with excess unlabeled protein

    • Antibody blocking experiments in interaction studies

  • Technical validation controls:

    • Range of substrate concentrations to establish enzyme kinetics

    • Multiple detergent conditions to rule out detergent artifacts

    • Replicate measurements across independent protein preparations

These methodologically rigorous controls address the specific challenges of working with membrane proteins and ensure that observed effects are specifically attributable to frdD function.

How can researchers validate antibodies against frdD for immunological studies?

Comprehensive antibody validation for frdD research should include:

  • Specificity validation:

    • Western blot analysis using recombinant frdD and whole-cell lysates

    • Comparison of wildtype versus frdD deletion mutant reactivity

    • Pre-absorption controls with purified antigen

    • Cross-reactivity testing against related proteins

  • Application-specific validation:

    • For immunoprecipitation: Pull-down efficiency quantification

    • For immunofluorescence: Colocalization with membrane markers

    • For ELISA: Standard curve generation with purified protein

    • For flow cytometry: Signal-to-noise ratio optimization

  • Multiple antibody approach:

    • Generation of antibodies against different epitopes

    • Comparison of monoclonal versus polyclonal antibody performance

    • Use of tagged recombinant proteins to enable commercial tag antibodies as alternatives

These validation strategies ensure that immunological studies targeting frdD produce reliable, reproducible data with minimal artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.