Recombinant Shigella boydii serotype 18 Glycerol-3-phosphate acyltransferase (plsY)

What is the structural composition of Shigella boydii serotype 18 plsY?

Shigella boydii serotype 18 Glycerol-3-phosphate acyltransferase (plsY) is a membrane-bound enzyme with 205 amino acid residues. The protein has a complete amino acid sequence of MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLIFdvlkgmlpvwgayelgvspfwlgliaiaaclghiwpvffgfkggkgvatafgaiapigwdltgvmagtwlltvllsgyss LGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE . This enzyme belongs to the acyltransferase family and possesses specific transmembrane domains that anchor it to the bacterial membrane. The protein structure includes multiple hydrophobic regions that facilitate membrane integration, which is critical for its biological function in phospholipid biosynthesis. Its structural features allow it to catalyze the acylation of glycerol-3-phosphate, a key step in bacterial membrane lipid synthesis.

How does plsY contribute to Shigella pathogenicity?

While plsY itself is not directly involved in virulence mechanisms like the O antigen, its fundamental role in membrane phospholipid synthesis indirectly contributes to pathogenicity. Proper membrane formation is essential for numerous virulence-associated functions in Shigella, including attachment to host cells, resistance to host defense mechanisms, and intracellular survival. Shigella is a well-known human pathogen that causes diseases such as diarrhea and bacillary dysentery . The integrity of the bacterial membrane, which depends on phospholipid biosynthesis enzymes like plsY, is crucial for the expression and function of other virulence factors, including O antigens that play a direct role in pathogenicity . Additionally, the evolutionary relationships between Shigella species impact their virulence profiles, with S. boydii having unique characteristics compared to other Shigella strains and E. coli.

What are the optimal conditions for storing recombinant Shigella boydii serotype 18 plsY?

For short-term storage of recombinant Shigella boydii serotype 18 plsY, maintaining the protein at 4°C for up to one week is recommended. For longer-term storage, the protein should be kept at -20°C, while extended storage is best accomplished at -80°C . The protein is typically stored in a Tris-based buffer containing 50% glycerol that has been optimized for stability. It's important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of enzymatic activity . For practical laboratory work, it is advisable to prepare small working aliquots to minimize freeze-thaw cycles. The following table summarizes the recommended storage conditions:

How is recombinant plsY typically expressed and purified for research purposes?

Expression of recombinant Shigella boydii serotype 18 plsY typically employs bacterial expression systems, most commonly E. coli strains optimized for membrane protein expression. Due to its membrane-bound nature, expression strategies often incorporate solubilization tags or fusion partners to enhance protein solubility and facilitate purification. Expression constructs generally include the full-length protein (residues 1-205) , though some protocols may use truncated versions for specific applications.

Purification typically follows a multi-step process:

• Cell lysis using methods gentle enough to preserve membrane protein structure

• Membrane fraction isolation via ultracentrifugation

• Detergent solubilization of membrane proteins

• Affinity chromatography using appropriate tags (determined during the production process)

• Size exclusion chromatography for further purification

• Buffer exchange to the final storage buffer containing 50% glycerol

The purified protein is then characterized for purity using SDS-PAGE and activity assays before being aliquoted and stored according to the recommended conditions.

What alternative names and identifiers are associated with Shigella boydii serotype 18 plsY?

Shigella boydii serotype 18 plsY is known by several alternative names and identifiers in scientific literature and databases. The recommended name is Glycerol-3-phosphate acyltransferase, but it is also referred to as G3P acyltransferase (abbreviated as GPAT), Lysophosphatidic acid synthase (abbreviated as LPA synthase), and by its gene name plsY . The gene has the synonym ygiH and the ordered locus name SbBS512_E3490 in the Shigella boydii serotype 18 genome (strain CDC 3083-94 / BS512) . In the UniProt database, this protein is identified by the accession number B2U1G3 . These various identifiers are important for researchers conducting literature searches, database queries, and comparative genomic analyses. The enzyme is classified by the Enzyme Commission numbers EC 2.3.1.15 and EC 2.3.1.n5, indicating its specific catalytic activity in transferring acyl groups.

What structural challenges arise when studying plsY for inhibitor design?

Developing inhibitors for glycerol-3-phosphate acyltransferase (GPAT) isozymes like plsY presents significant challenges due to the absence of direct structural information for many membrane-bound GPAT variants . Unlike soluble enzymes, membrane-bound GPATs are difficult to crystallize, limiting high-resolution structural studies. Research on GPAT inhibitors has relied on structural information from related enzymes, such as the squash chloroplast GPAT crystal structure, which provides only approximate insights for bacterial plsY .

In silico docking experiments with this surrogate structure have revealed that certain inhibitor scaffolds, particularly cyclopentyl and cyclohexyl scaffolds, may be occluded from the enzyme active site by two protein loops that sterically guard the phosphate binding region . This suggests that effective inhibitor design should focus on planar frameworks that can navigate between these loops to access the active site. The structural complexity is further compounded by conformational changes that may occur during substrate binding, which are difficult to predict without direct structural information on the target enzyme.

Researchers must therefore employ creative approaches, including:

• Development of homology models based on related enzymes

• Molecular dynamics simulations to understand protein flexibility

• Fragment-based drug discovery to identify binding motifs

• Structure-activity relationship studies with diverse inhibitor chemotypes

How can enzyme kinetics of plsY be accurately measured considering its membrane-bound nature?

Measuring enzyme kinetics of membrane-bound plsY presents unique methodological challenges that require specialized approaches. Traditional spectrophotometric assays used for soluble enzymes must be adapted for membrane proteins. A comprehensive approach includes:

• Preparation of enzyme samples:

  • Using detergent-solubilized purified enzyme

  • Reconstituting the enzyme in liposomes or nanodiscs to mimic native membrane environment

  • Using isolated membrane fractions containing overexpressed plsY

• Kinetic assay methodologies:

  • Radiometric assays tracking incorporation of radiolabeled acyl groups

  • HPLC-based methods for product (lysophosphatidic acid) quantification

  • Coupled enzyme assays linking plsY activity to measurable spectrophotometric changes

• Data analysis considerations:

  • Accounting for substrate partitioning between aqueous and membrane phases

  • Correcting for detergent effects on substrate availability

  • Addressing potential cooperativity in membrane-associated enzymes

When analyzing kinetic data, researchers should employ appropriate models that consider the two-dimensional nature of membrane-bound catalysis rather than traditional Michaelis-Menten kinetics developed for three-dimensional solution reactions. This may involve adapting surface dilution kinetics models or developing novel mathematical frameworks to accurately represent the unique constraints of membrane-bound enzyme catalysis.

How does plsY from Shigella boydii compare with GPAT enzymes from other organisms in terms of inhibitor sensitivity?

Comparative analysis of GPAT enzymes across species reveals important differences in inhibitor sensitivity, with implications for selective targeting of bacterial enzymes like Shigella boydii plsY. While mammalian GPAT isozymes are central control points for fat synthesis and potential obesity treatment targets , bacterial plsY enzymes differ significantly in structure and function, offering opportunities for selective inhibition.

Research on conformationally constrained glycerol 3-phosphate analogs has shown varying efficacy against different GPAT variants. In particular, the bacterial plsY exhibits different sensitivity patterns compared to mammalian GPATs. Docking studies using the squash chloroplast GPAT crystal structure have provided insights into these differences, suggesting that structural features unique to bacterial enzymes affect inhibitor binding .

Key differences include:

• The presence of specific protein loops in bacterial plsY that guard the phosphate binding region

• Different substrate binding pocket architectures between bacterial and mammalian GPATs

• Variations in membrane association mechanisms that affect inhibitor access

These structural differences suggest that inhibitor design strategies should focus on planar frameworks that can effectively navigate the unique structural constraints of bacterial plsY . Such inhibitors could potentially provide selective activity against bacterial pathogens without affecting mammalian GPAT function, which would be advantageous for antimicrobial development with minimal host toxicity.

What are effective approaches for analyzing plsY-substrate interactions?

Analyzing interactions between plsY and its substrates requires multi-faceted approaches that account for the membrane-bound nature of the enzyme. Several effective methodologies include:

• Biophysical techniques:

  • Surface plasmon resonance with immobilized enzyme in lipid bilayers

  • Isothermal titration calorimetry with detergent-solubilized enzyme

  • Microscale thermophoresis for detecting binding in complex environments

  • Fluorescence-based binding assays using fluorescently labeled substrates

• Structural approaches:

  • Hydrogen-deuterium exchange mass spectrometry to identify substrate binding regions

  • Cross-linking coupled with mass spectrometry to capture transient interactions

  • Molecular dynamics simulations to model substrate binding and enzyme conformational changes

• Functional analyses:

  • Site-directed mutagenesis of predicted binding residues followed by activity assays

  • Competition studies with substrate analogs to map binding determinants

  • Pre-steady-state kinetics to resolve individual steps in the catalytic mechanism

These complementary approaches can provide comprehensive insights into how plsY interacts with its substrates, including glycerol-3-phosphate and acyl donors. Understanding these interactions at the molecular level is essential for rational design of inhibitors that can effectively target the enzyme's active site despite the challenges posed by its membrane-bound nature.

How can genetic engineering approaches be used to study plsY function in Shigella?

Genetic engineering provides powerful tools for studying plsY function in Shigella boydii. Drawing from approaches used with other Shigella species, researchers can develop sophisticated strategies to interrogate plsY function:

• Gene modification techniques:

  • CRISPR-Cas9 gene editing for precise modification of plsY

  • Conditional knockout systems using inducible promoters

  • Site-directed mutagenesis to introduce specific amino acid changes

  • Plasmid-based complementation systems, similar to those developed for S. flexneri

• Expression systems:

  • Controlled expression using inducible promoters

  • Fusion with reporter proteins for localization studies

  • Epitope tagging for immunoprecipitation experiments

• Functional analysis:

  • Growth rate measurements under various conditions

  • Membrane composition analysis in modified strains

  • Virulence assessment in cellular and animal models

  • Phospholipid profiling using mass spectrometry

The transformation methodologies developed for Shigella flexneri, which include modification of O-antigen genes and other membrane components , can be adapted for S. boydii to study plsY function. These approaches allow researchers to directly link genetic modifications to phenotypic outcomes, providing insights into the role of plsY in bacterial physiology and pathogenesis.

What assay systems can be used to screen for potential plsY inhibitors?

Developing effective screening assays for plsY inhibitors requires methodologies that account for the enzyme's membrane association while providing sufficient throughput for drug discovery. Several complementary approaches can be employed:

• Primary screening assays:

  • Colorimetric assays measuring release of free CoA or phosphate

  • Fluorescence-based assays using environment-sensitive probes

  • Radiometric assays tracking transfer of radiolabeled acyl groups

  • FRET-based assays for monitoring substrate-product conversion

• Secondary validation assays:

  • Liposome-based reconstitution systems measuring actual product formation

  • Cellular assays assessing impact on bacterial phospholipid synthesis

  • Membrane permeability assays to evaluate effects on membrane integrity

• Target engagement confirmation:

  • Thermal shift assays to detect ligand binding

  • Competitive binding assays with known substrates

  • Mass spectrometry-based approaches to confirm direct interaction

Based on insights from prior GPAT inhibitor studies, design considerations should focus on planar molecular frameworks that can effectively navigate the protein loops guarding the phosphate binding region . This structural knowledge, combined with appropriate assay systems, provides a foundation for identifying compounds that can effectively inhibit plsY function in a selective manner.

How should contradictory results in plsY enzymatic studies be addressed?

Contradictory results in plsY enzymatic studies are not uncommon due to the technical challenges associated with membrane protein research. Addressing these contradictions requires systematic evaluation of methodological differences and careful consideration of experimental conditions:

• Methodological factors to evaluate:

  • Enzyme preparation methods (detergent-solubilized vs. membrane fractions vs. liposome-reconstituted)

  • Assay conditions (buffer composition, pH, temperature, ionic strength)

  • Substrate presentation (micelles, vesicles, or direct addition)

  • Detection methods and their limitations

• Analytical approaches:

  • Side-by-side comparison of different methodologies using the same enzyme preparation

  • Systematic variation of experimental parameters to identify condition-dependent effects

  • Collaborative cross-laboratory validation studies

  • Meta-analysis of published data with careful attention to methodological details

• Reporting considerations:

  • Detailed documentation of all experimental conditions

  • Transparent presentation of both supporting and contradictory data

  • Discussion of limitations and potential confounding factors

  • Explicit statement of assumptions made in experimental design and data interpretation

When encountering contradictory results, researchers should consider whether the discrepancies reflect actual biological variability, such as allosteric regulation or conformational flexibility, rather than experimental artifacts. In some cases, apparent contradictions may provide valuable insights into the complex behavior of membrane-bound enzymes like plsY.

What are the key considerations when comparing plsY across different Shigella species?

Comparing plsY across different Shigella species requires careful consideration of evolutionary relationships, genome organization, and physiological context. Key factors to consider include:

• Evolutionary relationships:

  • While most Shigella and E. coli strains are considered a single species, exceptions exist, such as S. boydii type 13

  • Sequence variations may reflect adaptations to specific ecological niches

  • Horizontal gene transfer events may have introduced strain-specific variations

• Structural and functional analysis:

  • Amino acid sequence alignment to identify conserved and variable regions

  • Structural homology modeling to predict functional implications of sequence variations

  • Enzyme kinetic comparisons under standardized conditions

  • Expression level and regulation differences across species

• Genomic context:

  • Analysis of operon structure and co-regulated genes

  • Identification of species-specific regulatory elements

  • Evaluation of potential functional interactions with other metabolic pathways

When comparing experimental results across species, it's important to standardize methodologies and account for differences in membrane composition, growth conditions, and physiological state. The genetic diversity observed across Shigella species, including the unique characteristics of S. boydii serotype 18, provides valuable natural variation for understanding structure-function relationships in plsY enzymes.

How can researchers effectively translate in vitro findings about plsY to in vivo significance?

Translating in vitro findings about plsY to in vivo significance presents challenges due to the complex cellular environment and multiple levels of regulation that exist in living systems. Effective translation strategies include:

• Stepwise complexity approaches:

  • Progression from purified enzyme to membrane fractions to whole cells

  • Use of reconstituted systems with increasing compositional complexity

  • Implementation of ex vivo assays using isolated bacterial membranes

• Genetic validation strategies:

  • Targeted mutations based on in vitro findings

  • Complementation studies with modified plsY variants

  • Conditional expression systems to control plsY levels

  • CRISPR interference for partial gene suppression

• Physiological relevance assessment:

  • Measurement of membrane phospholipid composition changes

  • Growth and survival analysis under various stress conditions

  • Evaluation of virulence factor expression and function

  • Host-pathogen interaction studies using cellular and animal models