Recombinant Shigella boydii serotype 18 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Shigella boydii

Shigella boydii is a Gram-negative bacterium and one of the four species of Shigella that cause shigellosis, also known as bacillary dysentery, in humans . Shigella species are closely related to Escherichia coli and cause disease through infection of the intestinal epithelium . S. boydii is further divided into serotypes based on distinct O-antigens, which are components of the lipopolysaccharide (LPS) on the bacterial cell surface . As of 2003, there were 18 recognized serotypes of S. boydii .

In Thailand, between 2001 and 2005, S. sonnei was the most frequent Shigella species isolated from patients, while S. dysenteriae and S. boydii were uncommon . The serotypes of S. boydii isolates were serotypes 2, 4, 10, and 12 .

Large-conductance Mechanosensitive Channel (MscL)

MscL is a bacterial mechanosensitive channel of large conductance, functioning as an emergency release valve, discharging cytoplasmic solutes upon osmotic stress . Inappropriate opening of the MscL pore is detrimental to the cell, leading to speculation that it could be a potential antibiotic target .

MscL Structure and Function

MscL is one of the best-studied mechanosensitive channels . The MscL protein contains an α-helix that runs along the cytoplasmic membrane and interacts with a neighboring subunit . Similar motifs have been observed in other prokaryotic and eukaryotic channels .

Recombinant MscL

Recombinant MscL proteins are produced using genetic engineering techniques, where the gene encoding MscL is inserted into a host organism (e.g., E. coli) to produce large quantities of the protein . For example, a recombinant full-length Shigella boydii serotype 4 Large-conductance mechanosensitive channel (MscL) protein with a His-tag has been expressed in E. coli .

4.1. Properties of Recombinant MscL Protein

PropertyDescription
SpeciesShigella boydii serotype 4
SourceE. coli
TagHis
Protein LengthFull Length (1-136 amino acids)
FormLyophilized powder
Amino Acid SequenceMSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLAEIRDLLKEQNNRS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

4.2. Reconstitution Protocol

It is recommended to briefly centrifuge the vial before opening to bring the contents to the bottom . Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ . The default final concentration of glycerol is 50% .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SbBS512_E3677; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLAEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What distinguishes Shigella boydii serotype 18 from other Shigella species and serotypes?

Shigella boydii serotype 18 (previously known as provisional serotype 1344-78 or E10163) was formally admitted to the Shigella schema based on comprehensive biochemical and serological characterization. Unlike other Shigella species, S. boydii comprises 20 different serotypes, with serotype 18 being one of the three later additions (along with serotypes 16 and 17) after 1958 . Biochemical characterization shows typical Shigella reactions, including non-motility in SIM medium, non-lactose fermentation on MacConkey agar, colorless colonies on XLD medium, and negative citrate utilization . Serologically, S. boydii serotype 18 possesses unique O-antigen structures that distinguish it from other serotypes. The comprehensive distribution analysis of S. boydii serotypes in Bangladesh revealed that type 18 represents approximately 7.6% of all S. boydii isolates, making it the fifth most prevalent serotype after types 12, 1, 4, and 14 .

What is the molecular structure and gating mechanism of the MscL channel?

The large-conductance mechanosensitive channel (MscL) functions as a critical pressure-relief valve that protects bacteria from osmotic lysis during hypoosmotic shock. Structural studies of MscL homologs, particularly from Methanosarcina acetivorans, have revealed significant conformational states including closed and expanded intermediate configurations . The channel consists of multiple structural domains including two transmembrane helices (TM1 and TM2) per subunit that undergo large tilting movements during channel gating. When the membrane is stretched during hypoosmotic conditions, MscL responds to increased membrane tension by opening a nonselective pore approximately 30 Å in diameter, which exhibits a remarkable unitary conductance of approximately 3 nS . The gating mechanism follows a helix-pivoting model where both transmembrane helices change their tilt angles relative to the membrane plane. This coordinated rearrangement of multiple structural elements enables the transformation from a folded periplasmic loop structure with an ω-shape in the closed state to an expanded conformation capable of releasing cytoplasmic solutes rapidly .

How do you correctly identify and classify Shigella boydii serotype 18 in clinical and environmental samples?

Accurate identification of S. boydii serotype 18 requires a systematic approach combining traditional biochemical tests and molecular methods:

  • Initial isolation and biochemical screening: Culture specimens on selective media such as Hektoen enteric (HE) agar, xylose lysine deoxycholate (XLD) agar, and MacConkey agar. Suspect S. boydii colonies appear green on HE, colorless on XLD, and as non-lactose fermenters on MacConkey agar .

  • Confirmatory biochemical testing: Apply tests including triple sugar iron (TSI), sulfide indole motility (SIM) medium, ornithine decarboxylase (ODC), lysine iron agar (LIA), Simmons citrate, and urea agar to differentiate from other Enterobacteriaceae .

  • Serological confirmation: Traditional serotyping uses commercially available polyvalent and monovalent antisera through agglutination tests. For S. boydii serotype 18, specific antisera are required, though cross-reactivity with some E. coli O-antigens may occur .

  • Molecular verification: Whole genome sequencing (WGS) and k-mer-based identification approaches provide superior discrimination between closely related species and serotypes, including accurate identification of S. boydii serotype 18 .

  • Alternative diagnostic approaches: While not yet developed for serotype 18, bacteriophage-based typing systems (similar to the MK-13 phage used for S. boydii type 1) could theoretically provide rapid, cost-effective alternatives to traditional serotyping methods in resource-limited settings .

What are the optimal expression systems for producing recombinant S. boydii serotype 18 MscL?

The optimal expression system for recombinant S. boydii serotype 18 MscL should balance protein yield, proper membrane insertion, and functional integrity. Based on established protocols for other MscL homologs, the following expression systems are recommended:

E. coli-based expression systems:

  • pET vector series: The pET28a(+) vector with an N-terminal His6-tag remains the standard system for MscL expression, providing good yields under IPTG induction. This system is particularly effective when used with E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression.

  • pBAD system: For more controlled expression, the arabinose-inducible pBAD system offers finer regulation, reducing potential toxicity associated with MscL overexpression.

Expression conditions optimization table:

ParameterRecommended RangeOptimization Notes
Induction temperature18-25°CLower temperatures reduce inclusion body formation
Inducer concentration0.1-0.5 mM IPTG or 0.002-0.2% arabinoseTitrate to balance yield and proper folding
Expression duration4-16 hoursExtended times at lower temperatures typically improve yield
Media compositionLB or TB with 0.2-0.5% glucose pre-inductionGlucose prevents leaky expression
Membrane mimetics0.5-2% detergent (DDM, LDAO, or OG)Critical for extraction and stabilization

For structural and biophysical studies, fusion protein strategies similar to those used for the M. acetivorans MscL could be adapted, where specific fusion partners helped trap the channel in defined conformational states . When designing constructs, careful consideration of the C-terminal domain is essential, as this region contains elements that participate in channel assembly and modulation.

How can you verify the proper folding and membrane insertion of recombinantly expressed MscL?

Verification of proper folding and membrane insertion of recombinant S. boydii serotype 18 MscL requires multiple complementary approaches:

  • Subcellular fractionation: Following expression, separate cellular fractions (cytoplasmic, membrane, and inclusion bodies) by differential centrifugation. Western blotting using anti-His antibodies should detect MscL predominantly in the membrane fraction if correctly inserted.

  • Detergent screening: Systematic testing of detergent extraction efficiency provides indirect evidence of proper membrane integration. A properly folded and inserted MscL typically shows preferential solubilization in mild detergents like DDM (n-dodecyl-β-D-maltoside) or LDAO (lauryldimethylamine oxide).

  • Size-exclusion chromatography (SEC): Well-folded MscL should elute as a monodisperse peak corresponding to a pentameric assembly. Multiple peaks or aggregation in the void volume suggests improper folding.

  • Circular dichroism (CD) spectroscopy: The alpha-helical content of properly folded MscL can be confirmed using CD spectroscopy, with characteristic minima at 208 and 222 nm. Based on structural data from MscL homologs, S. boydii serotype 18 MscL should exhibit approximately 60-65% alpha-helical content.

  • Functional reconstitution: The ultimate verification comes from functional assays where purified MscL is reconstituted into liposomes for electrophysiological measurements or fluorescent dye release assays in response to membrane tension.

A systematic approach incorporating these complementary methods provides confident assessment of proper MscL folding and membrane insertion before proceeding to more complex functional characterization.

What electrophysiological approaches are most suitable for characterizing recombinant S. boydii serotype 18 MscL?

For comprehensive electrophysiological characterization of recombinant S. boydii serotype 18 MscL, researchers should employ several complementary approaches:

  • Patch-clamp in reconstituted systems: The gold standard approach involves reconstituting purified MscL into azolectin liposomes and using either:

    • Excised patch configuration: Allows direct control of membrane tension through negative pressure application

    • Inside-out patch configuration: Enables manipulation of the cytoplasmic environment during channel activation

  • Planar lipid bilayer recordings: This alternative approach is particularly valuable for achieving higher resolution recordings. The purified MscL is incorporated into planar bilayers formed across apertures in Teflon partitions or glass chips.

  • Parameter measurement protocol:

ParameterMethodologyExpected Values for MscL
ConductanceSingle-channel recording at varying voltages (-100 to +100 mV)~3 nS in standard recording solutions
Tension sensitivityGradual application of negative pressure (0-300 mmHg)Activation threshold typically 10-12 mN/m
Ion selectivityCurrent measurements under asymmetric ion conditionsExpected poor selectivity (PK+/PCl- ≈ 1-1.5)
Inactivation kineticsSustained tension application (>3 min)Minimal inactivation compared to other MS channels
Subconductance statesSingle-channel analysis at threshold tensionsMultiple substates representing partial openings
  • Critical considerations:

    • Membrane composition significantly affects MscL gating; therefore, systematic testing of different lipid compositions (variations in chain length, saturation, and headgroup) is essential

    • Recording temperature (20-37°C) can substantially alter gating parameters

    • Solution pH modulates gating threshold, particularly affecting the periplasmic loops

These approaches should reveal whether the S. boydii serotype 18 MscL exhibits distinct electrophysiological properties compared to well-characterized MscL homologs from E. coli or M. tuberculosis.

How can you assess the physiological role of MscL in Shigella boydii serotype 18 during osmotic stress?

To evaluate the physiological significance of MscL in S. boydii serotype 18 during osmotic challenge, a comprehensive experimental approach is required:

  • Gene knockout and complementation studies:

    • Generate a clean deletion of the mscL gene in S. boydii serotype 18 using CRISPR-Cas9 or homologous recombination

    • Create complementation strains expressing either wild-type or mutant forms of the channel

    • Compare growth and survival during hypoosmotic shock between wild-type, knockout, and complemented strains

  • Hypoosmotic survival assays:

    • Culture bacteria in media supplemented with 0.5M NaCl to late logarithmic phase

    • Abruptly dilute into hypotonic media (20-200 fold dilution)

    • Quantify survival by colony forming unit (CFU) counts

  • Real-time volume regulation measurements:

    • Load bacteria with self-quenching fluorescent dyes (e.g., calcein-AM)

    • Monitor fluorescence intensity changes during hypoosmotic challenge using flow cytometry or microplate reader

    • Calculate volume regulation capacity and kinetics

  • Membrane integrity assessment:

    • Use membrane-impermeable DNA dyes (propidium iodide) to quantify cell lysis during osmotic downshock

    • Monitor release of cytoplasmic enzymes (e.g., β-galactosidase) as a marker of membrane disruption

  • Combined stressors analysis:

    • Examine interactions between osmotic stress and other environmental challenges (pH, temperature, antimicrobials)

    • Particular focus on conditions relevant to S. boydii's pathogenesis in the human intestine

These approaches will reveal whether S. boydii serotype 18 MscL exhibits unique physiological adaptations compared to other bacterial mechanosensitive channels, potentially reflecting specialized adaptations to its particular ecological niche or pathogenic lifestyle.

How do mutations in key domains of S. boydii serotype 18 MscL affect channel gating properties?

Structure-function analysis of S. boydii serotype 18 MscL requires systematic mutagenesis of key domains identified through sequence alignment with well-characterized MscL homologs. Based on the structural insights from MscL channels in different conformational states , the following domains and mutations warrant investigation:

  • Transmembrane helix 1 (TM1) mutations:

    • The hydrophobic constriction residues (likely corresponding to V23, G26, and V30 in E. coli MscL) represent primary targets for mutagenesis

    • Introduction of hydrophilic residues (e.g., V23D, G26S, V30N) typically reduces the energy barrier for gating, resulting in a gain-of-function phenotype with channels activating at lower membrane tensions

    • Conversely, increasing hydrophobicity at these positions generally stabilizes the closed state

  • Transmembrane helix 2 (TM2) mutations:

    • Residues facing the lipid-protein interface are critical for sensing membrane tension

    • Systematic substitutions with residues of varying hydrophobicity and size can reveal the relative contribution of specific TM2 positions to mechanosensing

  • Periplasmic loop domain mutations:

    • Based on structural studies showing significant conformational changes in the periplasmic loop region during gating , targeted mutations in this region can stabilize either the closed or open conformations

    • Proline substitutions in the loop can restrict conformational flexibility and generally increase the tension threshold required for gating

  • C-terminal domain modifications:

    • Truncations or charge substitutions in the C-terminal domain typically alter gating kinetics rather than threshold sensitivity

Expected effects of key mutations on channel properties:

DomainMutation TypeExpected Effect on Gating ThresholdEffect on KineticsPhysiological Consequence
TM1 constrictionHydrophilic substitutionsDecreased (gain-of-function)Faster openingCell growth defects, increased susceptibility to antimicrobials
TM1 constrictionHydrophobic substitutionsIncreased (loss-of-function)Slower openingReduced survival during osmotic downshock
TM2-lipid interfaceIncreased hydrophobicityModerately increasedMinimal effectReduced sensitivity to moderate osmotic challenges
Periplasmic loopFlexibility-restrictingVariable, often increasedAltered adaptationComplex effects on survival depending on osmotic challenge rate
C-terminal domainCharge neutralizationMinimal effect on thresholdAltered inactivationImpaired recovery from repeated osmotic challenges

These structure-function relationships provide crucial insights into the molecular mechanisms of mechanosensation in S. boydii serotype 18 MscL and potentially reveal adaptations specific to this organism's environmental niche.

How does the lipid environment affect the function of recombinant S. boydii serotype 18 MscL?

The lipid environment profoundly influences MscL function through multiple mechanisms that affect channel structure, tension sensitivity, and gating kinetics. For recombinant S. boydii serotype 18 MscL, systematic investigation of lipid-protein interactions should consider:

  • Membrane thickness effects:

    • MscL channels exhibit hydrophobic matching with surrounding lipids

    • Systematic reconstitution into liposomes with varying acyl chain lengths (C14-C22) typically reveals that:

      • Thinner membranes (shorter acyl chains) reduce gating threshold by creating hydrophobic mismatch stress

      • Thicker membranes generally increase gating threshold by stabilizing the closed conformation

  • Lipid headgroup interactions:

    • Negatively charged lipids (phosphatidylglycerol, cardiolipin) often concentrate near positively charged residues at membrane interfaces

    • Incorporation of 10-30% negatively charged lipids typically enhances channel activity by altering local electric fields and membrane deformation energetics

  • Membrane curvature and lateral pressure:

    • Cone-shaped lipids (PE) and inverted cone-shaped lipids (lyso-PC) dramatically alter the lateral pressure profile

    • Controlled incorporation of these non-bilayer lipids can reveal their effects on channel conformational equilibrium

  • Cholesterol and membrane fluidity:

    • Systematic modulation of membrane fluidity through cholesterol incorporation (0-40%) typically reduces MscL activity by increasing membrane stiffness

    • Temperature-dependent studies (15-40°C) in defined lipid compositions help decouple fluidity effects from specific lipid interactions

Experimental approach for systematic investigation:

Lipid ParameterExperimental MethodExpected Effect on MscL Function
Acyl chain lengthReconstitution in PC lipids with varying chain lengths (DMPC, DPPC, POPC, DOPC)Shorter chains lower activation threshold
Headgroup chargeIncorporation of 0-30% PG or PS in PC backgroundNegative charge generally facilitates channel opening
Membrane curvatureAddition of PE, lyso-PC, or diacylglycerolNon-bilayer lipids dramatically alter tension sensitivity
Membrane fluidityTemperature variation and cholesterol incorporationIncreased fluidity typically enhances channel activity
Native lipid environmentExtraction and analysis of S. boydii membrane lipidsReveals potential adaptation to specific lipid composition

These investigations can reveal whether S. boydii serotype 18 MscL has evolved specific lipid sensitivities that reflect its pathogenic lifestyle and environmental adaptations distinct from other well-characterized MscL homologs.

How can computational modeling enhance our understanding of S. boydii serotype 18 MscL dynamics?

Computational approaches offer powerful tools for investigating MscL dynamics at spatiotemporal scales challenging to access experimentally. For S. boydii serotype 18 MscL, the following computational strategies are particularly valuable:

  • Homology modeling and refinement:

    • Generate initial structural models based on known MscL structures, particularly the closed and expanded intermediate states of M. acetivorans MscL

    • Refine models through energy minimization and molecular dynamics equilibration

    • Validate structural predictions through targeted experimental studies

  • Molecular dynamics (MD) simulations:

    • Equilibrium MD: Provides insights into channel stability and conformational fluctuations (typically 100-500 ns timescales)

    • Steered MD: Apply lateral membrane tension to observe initial gating transitions (typically requires 100-200 ns)

    • Coarse-grained MD: Enable longer timescale simulations (μs-ms) to capture complete gating transitions

  • Free energy calculations:

    • Umbrella sampling along defined reaction coordinates can quantify energy barriers between conformational states

    • Calculate potential of mean force (PMF) profiles for ion permeation through different channel conformations

  • Normal mode analysis and elastic network models:

    • Identify collective motions relevant to channel gating

    • Reduce computational complexity while capturing essential dynamics

Simulation parameters for optimal MscL modeling:

Simulation TypeSystem SizeRecommended DurationKey Observables
All-atom equilibrium~150,000 atoms (protein + ~400 lipids + water)250-500 nsRMSD, RMSF, lipid-protein contacts
All-atom tension-induced~150,000 atoms200-500 nsPore radius, transmembrane helix tilting, subunit rearrangements
Coarse-grained equilibrium~15,000 beads5-10 μsLarge-scale conformational transitions, lipid sorting effects
Umbrella samplingVariable50-100 ns per windowFree energy differences between states

These computational approaches can address questions difficult to resolve experimentally, such as:

  • The sequence of molecular events during tension-induced gating

  • Contributions of specific residues to the energetics of channel opening

  • Effects of lipid composition on lateral pressure profiles experienced by the channel

  • Differences in gating mechanisms between S. boydii serotype 18 MscL and other homologs

What are the potential biotechnological applications of recombinant S. boydii serotype 18 MscL?

Recombinant S. boydii serotype 18 MscL offers several promising biotechnological applications leveraging its unique properties as a large-conductance tension-sensitive nanovalve:

  • Controlled release systems:

    • MscL can be engineered with modifiable gates for remote triggering (light, pH, redox, ligand)

    • Potential applications include:

      • Drug delivery vehicles with tension-controlled release

      • Biosensors with flow-regulated output

      • Microfluidic valve systems responsive to pressure differentials

  • Antimicrobial screening platforms:

    • MscL-based systems can report on membrane perturbations caused by antimicrobial compounds

    • Engineered bacterial strains expressing modified S. boydii serotype 18 MscL could serve as sensors for:

      • Membrane-active antibiotic discovery

      • Evaluation of antimicrobial peptides targeting Shigella species

      • Screening compounds affecting bacterial osmoregulation

  • Mechanosensitive biosensors:

    • The channel can be coupled to reporter systems (fluorescent, enzymatic) to create cellular tension sensors

    • Applications include:

      • High-throughput screening for compounds affecting membrane properties

      • Cell-based force transduction studies

      • Environmental monitoring of osmotic fluctuations

  • Protein structure-function studies:

    • The large pore size and well-defined gating transitions make MscL an excellent model system for:

      • Investigating fundamental principles of mechanosensation

      • Testing computational predictions of membrane protein dynamics

      • Exploring membrane-protein interactions in defined environments

Engineering considerations for specific applications:

ApplicationKey Engineering ModificationsTechnical ChallengesPotential Advantages of S. boydii Serotype 18 MscL
Controlled releaseIntroduction of light-sensitive or pH-sensitive residues in the pore constrictionMaintaining channel stability with modificationsPotentially unique gating properties optimized for intestinal environment
Antimicrobial screeningCoupling to fluorescent reporters through C-terminal fusionsSignal-to-noise ratio in complex mediaRelevance to enteric pathogen membrane properties
MechanosensorsIntegration with FRET pairs to report on conformational changesCalibration and standardizationNovel tension sensitivity range potentially distinct from E. coli MscL
Fundamental researchIntroduction of site-specific probes for spectroscopic studiesExpression and purification challengesInsights into mechanosensation in pathogenic context

These applications highlight the potential of S. boydii serotype 18 MscL to contribute to both fundamental membrane protein research and applied biotechnology in ways that may be distinct from more commonly studied MscL homologs.

What are common challenges in recombinant expression of S. boydii serotype 18 MscL and how can they be addressed?

Recombinant expression of membrane proteins like S. boydii serotype 18 MscL presents several challenges that require systematic troubleshooting:

  • Poor expression yield:

ChallengePossible CausesOptimization Strategies
Toxic effect on host cellsChannel activity disrupting host membrane integrity- Use tightly controlled inducible systems (pBAD)
- Express in C41/C43(DE3) strains resistant to membrane protein toxicity
- Add 0.2-0.5% glucose to growth media to prevent leaky expression
Codon usage biasRare codons in S. boydii sequence limiting translation- Use Rosetta or CodonPlus strains supplying rare tRNAs
- Optimize codon usage for expression host
- Express with a fusion partner known to enhance solubility
Protein degradationImproper folding triggering proteolysis- Lower induction temperature to 16-20°C
- Express in protease-deficient strains
- Include protease inhibitors during purification
  • Improper membrane insertion:

ChallengePossible CausesOptimization Strategies
Inclusion body formationOverwhelming the membrane insertion machinery- Reduce expression rate with lower inducer concentration
- Co-express with chaperones (GroEL/ES, DnaK/J)
- Test different signal sequences for targeting
MisfoldingImproper disulfide formation or membrane targeting- Add small amounts (0.1-0.5%) of mild detergents to growth media
- Include membrane-mimetic compounds like amphipols
- Try dual-vector systems separating expression of different domains
  • Purification difficulties:

ChallengePossible CausesOptimization Strategies
Poor detergent extractionIncompatible detergent selection- Screen detergent panel (DDM, LDAO, OG, DM, DMNG)
- Try detergent mixtures
- Optimize detergent:protein ratio
Aggregation during purificationUnstable in detergent micelles- Include stabilizing lipids (0.1-0.5 mg/ml)
- Maintain critical micelle concentration throughout
- Use styrene maleic acid (SMA) copolymers for native nanodisc formation
Low purityCo-purifying contaminants- Implement tandem purification (IMAC followed by size exclusion)
- Use stringent washing conditions
- Consider on-column detergent exchange
  • Functional reconstitution issues:

ChallengePossible CausesOptimization Strategies
Low reconstitution efficiencyDetergent removal rate too fast/slow- Optimize detergent removal method (dialysis vs. Bio-Beads)
- Test protein:lipid ratios (1:50 to 1:1000)
- Try different reconstitution temperatures
Inactive channelLoss of native conformation- Preserve native lipids during purification
- Re-examine detergent selection
- Add specific lipids (PE, PG) to reconstitution mixture

By implementing these systematic optimization strategies, researchers can overcome common challenges and successfully express functional S. boydii serotype 18 MscL for detailed characterization and application development.

How can genetic variability among S. boydii serotype 18 strains affect MscL expression and function?

Genetic diversity among S. boydii serotype 18 strains can significantly impact both the expression and functional properties of MscL. This variability requires careful consideration when designing recombinant expression systems and interpreting functional data:

  • Sequence variation analysis:

Variation TypePotential ImpactAssessment Approach
Single nucleotide polymorphisms (SNPs)Altered amino acid sequence affecting channel properties- PCR amplification and sequencing of mscL from multiple isolates
- Comparison with reference sequences
- Functional prediction of non-synonymous SNPs
Promoter region variationsDifferential expression levels under stress conditions- 5' RACE to identify transcriptional start sites
- Promoter activity assays under various stressors
- ChIP-seq for regulatory factor binding
Strain-specific post-translational modificationsAltered regulation of channel activity- Mass spectrometry analysis of native MscL
- Phosphoproteomic analysis under osmotic stress
- Site-directed mutagenesis of modified residues
  • Epidemiological considerations:

As noted in search result , S. boydii serotype 18 (originally designated as provisional serotype 1344-78) was isolated from multiple countries , suggesting potential geographical variation. ERIC-PCR fingerprinting approaches similar to those used for S. sonnei could reveal distinct genetic clusters of S. boydii serotype 18 with potentially different MscL properties.

  • Expression strategy adaptations:

Variation SourceAdaptation StrategyExpected Benefit
Codon usage differencesCreate codon-optimized synthetic genes for each major strain variantConsistent expression levels across variants
Regulatory element diversityDesign expression constructs with standardized regulatory elementsEliminate strain-specific expression biases
Amino acid sequence diversityExpress and characterize multiple strain variants in parallelIdentify functionally significant natural variations
  • Functional characterization considerations:

Natural genetic variation can reveal important structure-function relationships. Comparative analysis of MscL from different S. boydii serotype 18 isolates can identify:

  • Critical residues with high conservation (likely essential for function)

  • Variable regions (potentially involved in strain-specific adaptations)

  • Co-evolving residue networks (suggesting functional coupling)

These insights can inform both basic mechanistic understanding and biotechnological applications by revealing the molecular basis for functional differences between MscL variants and identifying the most suitable variants for specific research or application purposes.

How might the study of S. boydii serotype 18 MscL contribute to understanding bacterial adaptation to host environments?

Investigating S. boydii serotype 18 MscL in the context of host-pathogen interactions offers unique insights into bacterial adaptive mechanisms:

  • Adaptation to intestinal osmotic fluctuations:

    • The human intestinal environment undergoes significant osmotic variations during digestion

    • S. boydii MscL may exhibit specialized properties optimized for survival in this niche

    • Comparative osmotic survival assays between S. boydii and non-enteric bacteria can reveal pathogen-specific adaptations

  • Response to host defense mechanisms:

    • Antimicrobial peptides and complement proteins often disrupt bacterial membrane integrity

    • MscL may function as a sensor for membrane perturbations caused by host defense molecules

    • Research should examine MscL activation in response to physiologically relevant concentrations of host antimicrobial factors

  • Regulation during infection stages:

    • Transcriptomic and proteomic analysis of MscL expression during different infection phases

    • Investigation of potential cross-talk between virulence gene regulatory networks and mechanosensitive channel expression

    • Examination of MscL contribution to bacterial survival during transient exposure to hypotonic environments during host cell invasion

  • Modulation by intestinal metabolites:

    • Short-chain fatty acids and bile salts affect membrane properties

    • These host-derived factors may indirectly modulate MscL function by altering membrane fluidity or tension

    • Systematic testing of physiologically relevant concentrations of these compounds on MscL activity is warranted

This research direction connects fundamental biophysical characterization of MscL with the broader context of bacterial pathogenesis, potentially revealing:

  • Pathogen-specific adaptations in mechanosensation

  • Previously unrecognized roles for MscL in virulence

  • Novel therapeutic targets for disrupting bacterial adaptation to host environments

What novel methodological approaches are emerging for studying mechanosensitive channel function in pathogenic bacteria?

Cutting-edge methodological advances are transforming the study of mechanosensitive channels in pathogens like S. boydii:

  • In situ structural and functional studies:

    • Cryo-electron tomography: Visualizing MscL distribution and conformation in intact bacterial cells

    • Super-resolution microscopy: Tracking MscL clustering and dynamics during osmotic challenges

    • In-cell NMR: Monitoring structural changes in isotopically labeled MscL within living bacteria

  • Microfluidic approaches:

    • Gradient generators: Creating precisely controlled osmotic environments

    • Single-cell analysis platforms: Correlating MscL activity with individual bacterial survival

    • Organ-on-chip systems: Examining MscL function during simulated host-pathogen interactions

  • Genetic tools for functional analysis:

    • Optogenetic control: Light-activated MscL variants for precise temporal control

    • CRISPR interference: Tunable repression of MscL expression to determine dosage effects

    • Time-resolved transcriptomics: RNA-seq before, during, and after osmotic challenges

  • Advanced biophysical techniques:

    • High-speed atomic force microscopy: Directly visualizing conformational changes in membrane-embedded MscL

    • Magnetic tweezers: Applying precise mechanical forces to reconstituted MscL

    • Mass photometry: Analyzing MscL oligomeric state distributions in different lipid environments

Implementation considerations for these emerging techniques:

TechniqueKey Technical RequirementsPotential Insights for S. boydii MscL
Cryo-electron tomographyBacterial mini-cells or thin cell regionsNative distribution and clustering patterns
Microfluidic single-cell analysisFluorescent reporters of MscL activityHeterogeneity in response to osmotic stress
Optogenetic MscL variantsLight-sensitive residue incorporationConsequences of controlled MscL activation during infection
CRISPR interferencePAM sites near mscL promoterMinimum MscL levels required for osmotic protection
High-speed AFMStable MscL reconstitution in supported bilayersReal-time visualization of gating transitions

These emerging methodologies promise to bridge the gap between molecular understanding and physiological relevance, potentially revealing previously inaccessible aspects of MscL function in the context of bacterial pathogenesis and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.