Recombinant Shigella boydii serotype 18 NADH-quinone oxidoreductase subunit A (nuoA)

Basic Research Questions

• What is the structure and function of NADH-quinone oxidoreductase subunit A (nuoA) in Shigella boydii serotype 18?

NADH-quinone oxidoreductase subunit A (nuoA) in Shigella boydii serotype 18 is a 147-amino acid membrane protein that functions as part of Complex I in the respiratory electron transport chain. According to structural analyses, nuoA contains multiple transmembrane helices that anchor the protein within the bacterial inner membrane . The protein sequence (MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR) reveals hydrophobic regions consistent with membrane integration .

Functionally, nuoA contributes to the NADH:quinone oxidoreductase complex which catalyzes electron transfer from NADH to ubiquinone, coupled with proton translocation across the membrane. This activity generates the proton motive force essential for ATP synthesis and various energy-dependent cellular processes. Within the complex, nuoA likely contributes to proton translocation pathways and structural stability of the membrane domain.

Methodology for functional characterization:

• Site-directed mutagenesis of conserved residues to identify functional domains

• Reconstitution of purified protein into proteoliposomes for activity measurements

• Electron paramagnetic resonance (EPR) spectroscopy to study local environments

• Complementation studies in nuoA deletion mutants to verify function

• How do nuoA proteins from different Shigella species compare with other bacterial respiratory complexes?

Comparative analysis of nuoA proteins reveals both conserved functional domains and species-specific variations that may reflect evolutionary adaptations. The NADH-quinone oxidoreductase complex in Shigella shows significant homology to that of other enterobacteria, particularly Escherichia coli, reflecting their close evolutionary relationship .

Table 1: Comparative analysis of nuoA across bacterial species

The Na⁺-translocating NADH:quinone oxidoreductase (NQR) in Vibrio cholerae represents a functionally distinct respiratory complex that, despite similar electron transfer function, uses Na⁺ instead of H⁺ for ion translocation. This complex requires specific maturation factors including ApbE for flavin attachment and NqrM for Fe-S cluster assembly .

Research approaches for comparative studies:

• Multiple sequence alignment to identify conserved residues

• Homology modeling based on solved structures

• Phylogenetic analysis to trace evolutionary relationships

• Heterologous expression to test functional conservation

• What expression and purification strategies yield functional recombinant Shigella boydii nuoA?

Successful expression and purification of functional recombinant Shigella boydii nuoA requires specialized approaches due to its nature as an integral membrane protein:

Expression Systems:

• E. coli BL21(DE3) and derivatives offer high expression levels

• C41/C43 strains engineered for membrane protein expression reduce toxicity

• Codon optimization improves translation efficiency in heterologous systems

• Controlled induction at reduced temperatures (16-25°C) enhances proper folding

Construct Design:

• Addition of N-terminal or C-terminal His-tag facilitates purification

• Fusion partners (MBP, SUMO) can improve solubility and folding

• Signal sequences may improve membrane targeting

• Inclusion of TEV protease sites allows tag removal post-purification

Purification Protocol:

• Membrane fraction isolation by differential centrifugation

• Solubilization using mild detergents (DDM, LDAO)

• Immobilized metal affinity chromatography (IMAC)

• Size exclusion chromatography for final polishing

Storage Conditions:

• Store at -20°C/-80°C with 50% glycerol as cryoprotectant

• Avoid repeated freeze-thaw cycles

• Aliquot for single use to maintain protein integrity

Quality assessment methods include SDS-PAGE for purity evaluation, circular dichroism for secondary structure verification, and functional reconstitution assays to confirm activity.

• What are the key biochemical properties and handling considerations for recombinant Shigella boydii nuoA protein?

Understanding the biochemical properties of recombinant Shigella boydii nuoA is essential for experimental design and interpretation:

Table 2: Biochemical properties of recombinant nuoA protein

Critical Handling Factors:

• Maintain detergent above critical micelle concentration throughout purification

• Consider lipid supplementation to stabilize protein structure

• Perform functional assays promptly after thawing

• Monitor aggregation state using dynamic light scattering

When reconstituting lyophilized protein, add sterile deionized water to achieve 0.1-1.0 mg/mL concentration, followed by gentle mixing rather than vortexing to prevent aggregation .

Advanced Research Questions

The nuoA subunit plays a crucial role in both the structural integrity and functional capacity of the NADH-quinone oxidoreductase complex:

Structural Contributions:

Functional Roles:

• Creates part of the proton translocation pathway through conserved charged residues

• Contributes to conformational changes during catalytic cycle

• May participate in quinone binding site formation at the membrane interface

• Influences coupling efficiency between electron transfer and proton pumping

Research methodologies to investigate nuoA contributions include:

• Cross-linking mass spectrometry to map interactions with neighboring subunits

• Single-particle cryo-EM to determine structural positioning

• Site-directed mutagenesis of conserved residues followed by activity measurements

• Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Studies in related organisms have demonstrated that nuoA mutations can disrupt assembly of the entire complex, highlighting its importance as a core structural component even though it lacks redox cofactors itself .

• What is the relationship between nuoA function and bacterial pathogenesis in Shigella boydii?

The contribution of nuoA to Shigella boydii pathogenesis extends beyond its primary role in energy metabolism, affecting multiple aspects of the infection process:

Virulence Connections:

• Energy production required for invasion and intracellular replication

• Maintenance of redox balance affecting virulence factor expression

• Potential role in adaptation to oxygen-limited environments within host tissues

• Contribution to stress resistance during host immune response

Experimental Approaches:

• Generate precise nuoA deletion mutants using allelic exchange

• Evaluate impact on virulence using tissue culture models of invasion

• Assess intracellular survival in macrophage and epithelial cell models

• Compare transcriptomes of wild-type and mutant strains during infection

• Use animal models to evaluate colonization and disease progression

In Vibrio cholerae, studies have revealed an unexpected connection between the NQR complex and iron homeostasis. Deletion of nqr genes resulted in upregulation of the FeoB iron transport system, suggesting respiratory chain components influence metal ion homeostasis critical for virulence . Similar mechanisms may exist in Shigella, providing new targets for therapeutic intervention.

• How does iron availability affect the expression and function of nuoA in Shigella boydii?

Iron availability significantly impacts nuoA expression and function, revealing a complex relationship between respiratory metabolism and metal homeostasis:

Based on studies in Vibrio cholerae, which contains a related NADH:quinone oxidoreductase complex, iron levels directly influence the expression of respiratory chain components . In V. cholerae, deletion of the nqr operon resulted in upregulation of iron transport genes, particularly feoB, enhancing growth with Fe²⁺ as an iron source .

Regulatory Mechanisms:

• Iron may directly regulate nuoA expression through Fur (ferric uptake regulator)

• Fe-S cluster availability affects assembly and activity of the complex

• Iron limitation may trigger compensatory expression of alternative respiratory enzymes

• Post-translational regulation may occur through iron-dependent protein modifications

Experimental Approaches:

• Quantitative real-time PCR to measure nuoA expression under varying iron conditions

• Reporter gene fusions to identify iron-responsive regulatory elements

• Chromatin immunoprecipitation to detect transcription factor binding

• Growth analysis in iron-limited media with different supplementation strategies

• Metabolomic profiling to detect shifts in central metabolism

The interdependence between respiratory chain function and iron homeostasis represents an important adaptation mechanism that allows Shigella to adjust its metabolism in response to the iron-restricted host environment during infection .

• What methodological approaches are most effective for studying structure-function relationships in Shigella boydii nuoA?

Investigating structure-function relationships in Shigella boydii nuoA requires an integrated approach combining molecular, biochemical, and biophysical techniques:

Structural Analysis Methods:

• Homology Modeling:

  • Generate structural models based on solved structures of homologous proteins

  • Validate using molecular dynamics simulations

  • Identify conserved domains and potential functional sites

• Biophysical Characterization:

  • Circular dichroism to assess secondary structure content

  • Fourier-transform infrared spectroscopy for membrane protein structure

  • Thermostability assays to identify stabilizing conditions

• High-Resolution Structural Studies:

  • Cryo-electron microscopy of the assembled complex

  • X-ray crystallography of stabilized protein or domains

  • Solid-state NMR to analyze membrane-embedded regions

Functional Analysis Methods:

• Site-Directed Mutagenesis:

  • Alanine scanning of conserved residues

  • Charge reversal mutations in proposed proton channels

  • Conservative substitutions to probe specific interactions

• Complementation Studies:

  • Expression of mutant variants in nuoA deletion strains

  • Phenotypic rescue assessment under different growth conditions

  • Competition assays to measure relative fitness

• Bioenergetic Measurements:

  • Membrane potential determination using fluorescent probes

  • Oxygen consumption measurements using electrode-based systems

  • ATP synthesis quantification to assess coupling efficiency

Integration of these approaches enables researchers to correlate structural features with specific functional aspects, providing insights that can guide therapeutic targeting or biotechnological applications.

• How does genetic diversity in Shigella boydii nuoA across different serotypes impact bacterial physiology?

Genetic diversity in nuoA across Shigella boydii serotypes has significant implications for bacterial physiology and potentially contributes to serotype-specific characteristics:

While Shigella boydii represents multiple phylogenetic lineages that emerged from E. coli relatively recently (50,000-270,000 years ago), sequence variations in respiratory chain components could influence adaptation to specific host environments . The genome diversity study of Shigella boydii identified that isolates separate into three distinct phylogenomic clades, each with specific gene content .

Comparative Analysis Methods:

• Whole genome sequencing of multiple S. boydii serotypes

• Targeted sequencing of the nuoA gene and flanking regions

• Transcriptomic profiling under standardized conditions

• Phenotypic characterization of growth and metabolic capabilities

Physiological Impacts of nuoA Variations:

• Differential efficiency of energy conservation

• Varied adaptation to oxygen-limited environments

• Altered sensitivity to respiratory chain inhibitors

• Differences in redox balance maintenance

Analysis of other Shigella species has shown considerable O-antigen diversity, with 33 distinct forms across Shigella clones, suggesting rapid evolution through lateral gene transfer and recombination . Similar evolutionary pressures may also drive diversification of respiratory chain components, including nuoA, contributing to serotype-specific metabolic adaptations.

• What approaches can be applied to develop specific detection methods for Shigella boydii serotype 18 nuoA?

Developing specific detection methods for Shigella boydii serotype 18 nuoA requires addressing the challenge of distinguishing it from highly similar homologs in related bacteria:

Nucleic Acid-Based Detection:

• PCR-Based Methods:

  • Design primers targeting serotype-specific regions of the nuoA gene

  • Develop multiplex PCR assays distinguishing between serotypes

  • Implement real-time PCR with serotype-specific probes

  • Consider digital PCR for absolute quantification

• Sequencing Approaches:

  • Targeted amplicon sequencing of nuoA and flanking regions

  • Whole genome sequencing for comprehensive strain identification

  • Nanopore sequencing for rapid field-deployable detection

Protein-Based Detection:

• Antibody Development:

  • Identify serotype-specific epitopes through sequence analysis

  • Develop monoclonal antibodies against unique regions

  • Implement ELISA-based detection systems

  • Adapt to lateral flow assays for point-of-care testing

• Mass Spectrometry:

  • Identify serotype-specific peptide markers

  • Develop selected reaction monitoring (SRM) assays

  • Implement MALDI-TOF approaches for rapid identification

Validation Requirements:

• Cross-reactivity testing against other Shigella species and E. coli strains

• Sensitivity and specificity determination

• Performance evaluation in complex biological matrices

• Field testing in relevant environmental or clinical samples

For optimal specificity, a combination of methods targeting both genetic and protein markers may be necessary, particularly when distinguishing between the closely related serotypes of Shigella boydii and E. coli strains .

• How can recombinant nuoA be utilized for vaccine development against Shigella boydii?

Utilizing recombinant nuoA for vaccine development against Shigella boydii presents both opportunities and challenges that require systematic investigation:

Vaccine Potential Assessment:

• Antigenicity Evaluation:

  • Analyze B-cell epitope prediction and conservation

  • Screen for T-cell epitopes using in silico and experimental methods

  • Assess cross-reactivity with other Shigella species and E. coli

  • Determine immunogenicity in animal models

• Delivery Strategy Development:

  • Evaluate recombinant protein formulations with adjuvants

  • Consider DNA vaccine approaches targeting nuoA

  • Develop attenuated strains expressing modified nuoA variants

  • Explore outer membrane vesicle (OMV) platforms incorporating nuoA

Challenges and Considerations:

• Limited accessibility of membrane-embedded epitopes

• Potential for cross-reactivity with commensal E. coli

• Need for broad protection across Shigella serotypes

• Requirement for mucosal immune responses

Experimental Approach:

• Produce highly purified recombinant nuoA or immunogenic fragments

• Formulate with appropriate adjuvants for mucosal delivery

• Characterize immune responses in animal models

• Assess protection against challenge with virulent Shigella boydii

• What is the potential of Shigella boydii nuoA as a target for novel antimicrobial development?

Shigella boydii nuoA represents a potential target for novel antimicrobial development based on its essential role in respiratory metabolism:

Target Validation Approaches:

• Essentiality Assessment:

  • Conditional knockout studies to verify growth requirements

  • Transposon mutagenesis screening to confirm lack of redundancy

  • Competitive growth assays to quantify fitness costs of inhibition

  • Verification across multiple Shigella strains and growth conditions

• Druggability Evaluation:

  • Structural analysis to identify potential binding pockets

  • Fragment-based screening to identify chemical starting points

  • In silico docking studies with virtual compound libraries

  • Differential analysis against human homologs for selectivity

Drug Discovery Methods:

• High-Throughput Screening:

  • Develop activity assays suitable for large-scale screening

  • Screen diverse chemical libraries against purified protein

  • Implement cell-based assays for whole-cell activity

  • Validate hits through secondary assays and target engagement studies

• Structure-Based Design:

  • Generate structural models of Shigella boydii nuoA

  • Identify binding site differences from human Complex I

  • Design compounds exploiting bacterial-specific features

  • Optimize lead compounds through medicinal chemistry

The increasing prevalence of extensively drug-resistant (XDR) Shigella infections, as highlighted by CDC reports, underscores the urgent need for new antimicrobial targets and approaches . Respiratory chain components like nuoA offer advantages as they are essential for energy metabolism and contain bacterial-specific features that may allow selective targeting.