Recombinant Shigella boydii serotype 18 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purity

Expression System

  • Host Organism: Exclusively produced in Escherichia coli via recombinant DNA technology .

  • Yield and Purity:

    • Purified to >90% homogeneity, as verified by SDS-PAGE .

    • Lyophilized powder formulation with a Tris/PBS-based buffer containing 6% trehalose (pH 8.0) .

Vaccine Development

  • Target: Explored as a candidate antigen for Shigella vaccines due to its conserved role in bacterial respiration and potential immunogenicity .

  • Advantages:

    • High purity enables reliable antigen presentation.

    • His-tag facilitates affinity chromatography for scalable production.

Diagnostic Assays

  • ELISA Detection: Used as a coating antigen in enzyme-linked immunosorbent assays to detect anti-Shigella antibodies .

  • Sensitivity: Quantitative detection enabled by standardized protocols for serum or sample analysis .

Pathogenicity and Metabolic Studies

  • Role in NDH-1 Function: Critical for proton translocation and ATP synthesis in Shigella .

  • Comparative Genomics: Studies highlight nuoK as a conserved gene across Shigella species, though serotype-specific variations exist .

Comparative Analysis with Other Shigella Subunits

FeatureS. boydii serotype 18 nuoKOther Shigella nuoK Subunits
Expression HostE. coliE. coli (conserved across species)
Purity>90% (SDS-PAGE)Variable (dependent on strain)
O Antigen LinkageNo direct associationSerotype-specific variations
Therapeutic PotentialVaccine candidateLimited reports

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery details, please consult your local distributor.
Important: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; SbBS512_E2655; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILSAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal handling and storage conditions for recombinant nuoK protein?

For maximum stability and activity retention, researchers should follow these protocols:

  • Storage: Maintain at -20°C/-80°C for long-term storage

  • Buffer composition: Typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Reconstitution: Briefly centrifuge before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Cryoprotection: Add glycerol to a final concentration of 5-50% (commonly 50%) for freeze storage

  • Working aliquots: Store at 4°C for up to one week to avoid repeated freeze-thaw cycles

  • Quality control: Purity is typically greater than 90% as determined by SDS-PAGE

These handling procedures ensure protein stability while minimizing activity loss during experimental workflows.

What experimental approaches can effectively evaluate nuoK function in the NDH-1 complex?

Multiple complementary techniques have proven valuable for investigating nuoK function:

  • Site-directed mutagenesis of conserved residues (particularly Glu-36 and Glu-72) followed by functional assessment

  • Enzyme activity assays:

    • dNADH-K₃Fe(CN)₆ reductase activity (measures electron transfer capacity)

    • NADH-DB oxidoreductase activity (evaluates quinone reduction)

    • ATP-driven reverse electron transfer (studies energy coupling)

  • Structural integrity assessment:

    • Blue Native PAGE (BN-PAGE) with NADH dehydrogenase activity staining

    • Immunoblotting to verify subunit content

  • Membrane potential measurements using fluorescent probes to evaluate proton-pumping capacity

  • Relocation mutagenesis to study the positional requirements of functional residues (e.g., relocating conserved glutamates along transmembrane segments)

These approaches collectively provide a comprehensive assessment of how nuoK contributes to NDH-1 assembly, electron transfer capacity, and proton translocation function.

How can researchers optimize expression and purification of recombinant nuoK?

Based on published protocols and membrane protein biochemistry principles:

  • Expression system selection:

    • E. coli has been successfully used for nuoK expression

    • Consider specialized strains designed for membrane proteins (C41/C43)

    • Use tunable promoters to control expression levels and prevent toxicity

  • Fusion tag strategy:

    • N-terminal His-tag has proven effective for nuoK purification

    • Alternative tags (MBP, SUMO) may improve solubility if needed

  • Membrane protein extraction:

    • Test different detergents (DDM, LMNG) for optimal solubilization

    • Consider nanodiscs for maintaining native-like environment

  • Purification workflow:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for final polishing

    • Quality control via SDS-PAGE and mass spectrometry

The recombinant protein quality can be validated through activity assays comparing to native protein preparations.

How do mutations in conserved glutamic acid residues affect nuoK function?

Research has identified two conserved glutamic acid residues in nuoK that are critical for NDH-1 activity. Extensive mutagenesis studies reveal differential contributions:

MutationLocationEffect on NDH-1 Activity
E36A/E36QTM2Complete loss of NDH-1 activities
E72A/E72QTM3Moderate but significant reduction
E36 relocated to positions 32, 38, 39, 40TM2Largely retained energy transducing activities

These findings demonstrate that Glu-36 plays a critical role in the proton translocation mechanism, while Glu-72 has a supportive but less essential function . Interestingly, when Glu-36 was relocated to nearby positions in the same helix phase, the mutants largely retained activity, suggesting some positional flexibility within the structural constraint of remaining in the same helical face .

What role does the cytoplasmic loop-1 of nuoK play in NDH-1 function?

The short cytoplasmic loop-1 of nuoK, comprising residues Arg-25, Arg-26, and Asn-27, has proven crucial for energy transduction despite its small size. Mutation studies show:

MutationEffect on AssemblyEffect on Activity
R25A, R25K, R25C, R25SNormal assemblySignificantly reduced activity
R26A, R26K, R26C, R26SNormal assemblySignificantly reduced activity
N27C, N27SNormal assemblyN27S showed ~75% of wild-type activity
R25A/R26A (double)Normal assemblyDrastic reduction in electron transfer and diminished electrochemical gradient

These results indicate that while mutations in loop-1 don't significantly affect NDH-1 assembly, they substantially impact its energy-transducing activity . The highly conserved nature of Arg-25 across species further emphasizes this loop's functional importance, potentially in coordinating conformational changes necessary for proton translocation.

How does nuoK contribute to the proposed proton translocation mechanism?

NuoK appears to play multiple roles in the proton translocation mechanism of NDH-1:

  • The highly conserved Glu-36 in TM2 likely participates directly in proton transfer, as its mutation completely abolishes energy transduction while maintaining electron transfer

  • NuoK's extensive interactions with NuoN and connection to helix HL of NuoL suggest it forms part of a conformationally coupled network essential for energy transduction

  • Recent research indicates that NDH-1/complex I lacking both NuoL and NuoM can still pump protons at H⁺/2e⁻ = 2, suggesting NuoK may be part of a core proton-pumping module

  • The conserved charged residues in nuoK likely form part of a proton translocation pathway, with Glu-36 serving as a proton donor/acceptor in the translocation process

Current models suggest that NuoK functions cooperatively with NuoA and NuoJ subunits in the coupling mechanism of NDH-1, contributing to the conformational changes that drive proton translocation across the membrane .

What is the evolutionary relationship between nuoK and the MrpC subunit of multisubunit Na⁺/H⁺ antiporters?

FeaturenuoKMrpC
Conserved Glu-36Perfectly conserved across speciesNot conserved
Conserved Glu-72Almost perfectly conserved across speciesNot conserved
Membrane topologyThree transmembrane segmentsSimilar membrane topology
FunctionNADH:quinone oxidoreductase componentNa⁺/H⁺ antiporter component

This comparison suggests that while nuoK and MrpC may share some structural features and common ancestry, they have evolved distinct functional properties . The absence in MrpC of the glutamate residues critical for nuoK function indicates divergent mechanisms for ion translocation. This evolutionary relationship provides insights into the diversification of ion-translocating membrane proteins during bacterial evolution.

How might nuoK contribute to pathogenicity or drug resistance in Shigella boydii?

While direct evidence linking nuoK to pathogenicity is limited, several hypotheses merit investigation:

  • Energy metabolism and survival: As part of the NDH-1 complex, nuoK contributes to cellular bioenergetics, potentially supporting bacterial survival under stress conditions encountered during infection

  • Potential connection to drug resistance: The rising concern about extensively drug-resistant Shigella strains in the United States3 raises questions about how metabolic adaptations might contribute to resistance mechanisms

  • Membrane potential maintenance: NuoK's role in proton translocation affects membrane potential, which can influence drug efflux pump efficiency and antibiotic uptake

  • Potential as a drug target: The essential nature of NDH-1 for bacterial energy metabolism makes nuoK a potential novel antibiotic target, especially given its divergence from human homologs

Researchers investigating these connections would benefit from studying nuoK expression and mutation patterns in clinical isolates with various resistance profiles, potentially revealing adaptations that enhance survival during antibiotic treatment.

What emerging technologies could advance our understanding of nuoK function?

Several cutting-edge approaches could provide new insights into nuoK function:

  • Cryo-electron microscopy to determine high-resolution structures of wild-type and mutant NDH-1 complexes containing nuoK, potentially revealing conformational changes during catalysis

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and conformational changes in nuoK during the catalytic cycle

  • Single-molecule FRET to track conformational changes in real-time during NDH-1 function

  • In silico molecular dynamics simulations to model proton transfer pathways involving nuoK's conserved residues

  • CRISPR-based genome editing to study the effects of nuoK mutations in various Shigella strains under different environmental conditions

These approaches would provide mechanistic insights beyond what conventional biochemical assays have revealed, particularly regarding the dynamic aspects of nuoK's role in energy transduction.

How might understanding nuoK function contribute to addressing drug-resistant Shigella infections?

With extensively drug-resistant Shigella strains emerging3, research on nuoK could contribute to new therapeutic approaches:

  • Structure-based drug design targeting the interface between nuoK and other NDH-1 subunits could yield novel antibiotics that disrupt energy metabolism

  • Understanding how nuoK contributes to bacterial bioenergetics might reveal metabolic vulnerabilities that could be exploited therapeutically

  • Comparative analysis of nuoK sequences from resistant and sensitive strains might identify mutations that contribute to adaptation under antibiotic pressure

  • Development of inhibitors specifically targeting bacterial respiratory complexes containing nuoK could provide alternatives to traditional antibiotics for which resistance has developed

Given that alternative antibiotics may not be available for patients with severe Shigella infections and compromised immune systems3, developing novel therapeutic approaches targeting fundamental bioenergetic processes represents a promising research direction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.