Recombinant Shigella boydii serotype 18 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mdoB; opgB; SbBS512_E4899; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRHRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIAAFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWQGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
Phosphoglycerol transferase I (mdoB) from Shigella boydii serotype 18 catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (mdoB) and what is its function?

Phosphoglycerol transferase I (mdoB) is an enzyme located in the inner, cytoplasmic membrane of gram-negative bacteria including Shigella boydii serotype 18. It catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides or to model substrates such as arbutin (p-hydroxyphenyl-beta-D-glucoside). The products of this reaction are phosphoglycerol diester derivatives of membrane-derived oligosaccharides and sn-1,2-diglyceride . The enzyme's active site is positioned on the outer aspect of the inner membrane, allowing it to interact with substrates in the periplasmic space. MdoB plays a critical role in the biosynthesis of membrane-derived oligosaccharides, which contribute to membrane integrity and bacterial adaptation to environmental stresses .

What are the structural characteristics of Shigella boydii serotype 18 mdoB protein?

The recombinant Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) mdoB protein consists of 763 amino acids with a UniProt accession number B2TZP2 . The protein functions as a phosphoglycerol transferase with EC number 2.7.8.20 and is also known as phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase . The gene is alternatively named opgB, with ordered locus name SbBS512_E4899. The protein contains multiple transmembrane domains consistent with its localization in the bacterial inner membrane. The structure includes regions responsible for substrate binding, catalytic activity, and membrane anchoring, allowing the enzyme to perform its function of transferring phosphoglycerol moieties across the membrane interface.

How does Shigella boydii serotype 18 relate to other Shigella species?

Shigella boydii serotype 18 is one of the more recently recognized serotypes of S. boydii, which is one of the four species of Shigella bacteria that cause shigellosis . The four species include S. sonnei, S. flexneri, S. boydii, and S. dysenteriae, which are further divided into serotypes and subserotypes . Serotype 18 of S. boydii was formerly known as provisional serotype 1344-78 (E10163) before being formally admitted to the Shigella schema . While S. boydii is uncommon in some regions like South Africa, where S. sonnei and S. flexneri type 2a predominate, S. boydii serotype 18 has been isolated from multiple countries, indicating its global distribution . Shigella species are increasingly developing resistance to commonly used antimicrobial agents, making the study of their proteins, including mdoB, particularly relevant for understanding pathogenicity and developing new therapeutic approaches .

What methodological approaches are most effective for expressing and purifying recombinant mdoB protein?

For optimal expression and purification of recombinant Shigella boydii serotype 18 mdoB protein, a multifaceted approach is recommended. The gene should be codon-optimized for the expression host (typically E. coli) to enhance protein production. Based on successful approaches with other Shigella proteins, the Codon Adaptive Index (CAI) should be increased to approximately 0.9 for optimal expression . Expression vectors containing T7 or pET systems with appropriate affinity tags (His-tag is commonly used) facilitate downstream purification. For membrane proteins like mdoB, expression conditions should be carefully optimized:

ParameterRecommended ConditionRationale
Expression strainE. coli BL21(DE3)Deficient in proteases; compatible with T7 system
Growth temperature16-20°C post-inductionReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGLower concentrations favor proper folding
Growth mediumTerrific Broth (TB)Supports higher cell density
Harvest time16-18 hours post-inductionAllows sufficient protein accumulation

Purification typically involves membrane fraction preparation followed by detergent solubilization (n-dodecyl β-D-maltoside or CHAPS are often effective), followed by affinity chromatography. Size exclusion chromatography as a final step helps obtain highly pure protein. For long-term storage, the purified protein should be kept in Tris-based buffer with 50% glycerol at -20°C or -80°C, avoiding repeated freeze-thaw cycles .

How can researchers effectively assess the enzymatic activity of recombinant mdoB protein?

Assessing the enzymatic activity of recombinant mdoB protein can be accomplished through multiple complementary approaches. The classic assay involves measuring the transfer of phosphoglycerol residues from radiolabeled phosphatidylglycerol to arbutin or membrane-derived oligosaccharides. A more accessible alternative is monitoring the production of sn-1,2-diglyceride, the other product of the reaction.

Protocol outline for enzymatic activity assessment:

  • Prepare membrane vesicles containing recombinant mdoB or purified protein reconstituted in liposomes.

  • Incubate with phosphatidylglycerol (unlabeled or 32P-labeled) and arbutin (as model substrate).

  • Extract lipids and analyze by thin layer chromatography to detect sn-1,2-diglyceride formation.

  • Alternatively, use mass spectrometry to detect phosphoglycerol-arbutin adducts.

What are the optimal conditions for handling and storing recombinant mdoB protein?

Proper handling and storage of recombinant Shigella boydii serotype 18 mdoB protein is critical for maintaining enzymatic activity and structural integrity. The recommended storage conditions are as follows:

Storage PurposeRecommended ConditionsAdditional Notes
Short-term storage4°CMaintain in working aliquots for up to one week
Standard storage-20°CStore in Tris-based buffer with 50% glycerol
Long-term storage-80°CFor extended preservation of activity
Working conditionsKeep on iceWhen actively handling in experiments

The protein should be stored in a Tris-based buffer optimized for this specific protein, containing 50% glycerol to prevent freeze damage . It is strongly recommended to prepare small working aliquots to avoid repeated freeze-thaw cycles, as these can significantly reduce enzyme activity . When thawing, samples should be gently warmed at 4°C rather than at room temperature to prevent protein denaturation. For experimental use, the protein concentration should be adjusted based on specific assay requirements, typically in the range of 0.1-1.0 mg/mL for enzymatic studies.

How can researchers design mutation studies to investigate mdoB function?

Designing effective mutation studies for investigating mdoB function requires a strategic approach targeting conserved domains and catalytic residues. Based on sequence analyses and homology to related enzymes, several approaches are recommended:

  • Site-directed mutagenesis strategy:

    • Target conserved residues in the catalytic domain

    • Focus on transmembrane domains that anchor the protein

    • Modify residues at the active site facing the periplasmic space

  • Functional domains to target:

    • Phosphatidylglycerol binding sites

    • Oligosaccharide substrate recognition regions

    • Membrane-interaction domains

For in vivo studies, researchers can utilize the arbutin resistance phenotype as a selective marker . Strains with dgk mutations (defective in diglyceride kinase) that also carry mdoB mutations will show arbutin resistance, providing a convenient selection method for identifying functional mutations . This approach has been successfully used to identify mdoB mutants that map near minute 99 on the E. coli chromosome .

For complementation studies, the wild-type mdoB gene should be cloned into a low-copy-number vector to prevent overexpression artifacts. Expression can be verified using antibodies against either native mdoB or an attached epitope tag. Researchers should confirm that mutant phenotypes can be complemented by the wild-type gene to establish causality between the mutation and observed phenotypes.

What analytical techniques are most suitable for studying mdoB interactions with membrane components?

Studying mdoB interactions with membrane components requires specialized techniques that can capture the complexity of membrane protein associations. The following analytical approaches are particularly valuable:

  • Membrane reconstitution systems:

    • Proteoliposomes containing purified mdoB

    • Nanodiscs for controlled lipid environment studies

    • Planar lipid bilayers for electrophysiological measurements

  • Biophysical interaction analyses:

    • Surface plasmon resonance (SPR) with immobilized mdoB or substrate

    • Microscale thermophoresis for measuring binding affinities

    • Fluorescence resonance energy transfer (FRET) for proximity measurements

  • Structural biology approaches:

    • Cryo-electron microscopy for visualizing membrane-protein complexes

    • X-ray crystallography of stabilized protein (requires detergent optimization)

    • Nuclear magnetic resonance (NMR) for dynamic interaction studies

  • Chemical biology methods:

    • Photoaffinity labeling to capture transient interactions

    • Cross-linking mass spectrometry to identify interaction sites

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

When designing experiments to study mdoB-membrane interactions, researchers should consider the native environment of the enzyme, which spans the inner bacterial membrane with its active site facing the periplasm . The lipid composition of the membrane, particularly the presence of phosphatidylglycerol (the substrate for the enzymatic reaction), is critical for accurate assessment of protein function and interactions.

How can researchers overcome challenges in expressing membrane proteins like mdoB?

Expressing membrane proteins like mdoB presents unique challenges due to their hydrophobic nature and complex folding requirements. Researchers can implement several strategies to enhance success:

  • Expression system optimization:

    • Consider specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

    • Evaluate alternative hosts such as Lactococcus lactis or cell-free systems for difficult targets

    • Implement tight control of expression using tunable promoters (e.g., rhamnose-inducible)

  • Fusion partners and modifications:

    • N-terminal fusions with soluble partners (MBP, SUMO, Mistic) can enhance folding

    • Green fluorescent protein (GFP) fusions allow rapid screening for properly folded protein

    • Consider truncation constructs that maintain catalytic domains but remove problematic regions

  • Culture condition adjustments:

    • Supplement media with specific phospholipids to support membrane protein folding

    • Add chemical chaperones such as glycerol or trimethylamine N-oxide (TMAO)

    • Implement stress-response induction prior to protein expression (heat shock proteins)

For mdoB specifically, expression as a fusion protein with a highly soluble partner like MBP (maltose-binding protein) followed by on-column cleavage has shown success with similar membrane proteins. The key is to balance expression levels with the cell's capacity for proper membrane protein insertion. Too high expression levels often lead to inclusion body formation and non-functional protein.

What controls are essential for validating mdoB enzyme activity assays?

Rigorous controls are essential for validating mdoB enzyme activity assays and ensuring reliable, reproducible results. The following controls should be implemented:

Control TypeDescriptionPurpose
Negative enzyme controlHeat-inactivated mdoBConfirms activity is enzyme-dependent
Substrate specificity controlAlternative glycolipidsVerifies substrate specificity
Positive controlKnown active phosphoglycerol transferaseValidates assay conditions
Inhibition controlEDTA or metal chelatorsTests dependency on metal cofactors
Genetic complementationmdoB mutant + wild-type geneConfirms phenotype is mdoB-dependent
Kinetic analysisVarying substrate concentrationsEstablishes enzyme parameters (Km, Vmax)

For in vivo functional studies using the arbutin resistance phenotype, essential controls include strains with confirmed dgk mutations alone (arbutin-sensitive) and strains with both dgk and mdoB mutations (arbutin-resistant) . Additionally, complementation with plasmid-borne wild-type mdoB should restore arbutin sensitivity, confirming the specific role of mdoB in the observed phenotype.

For biochemical assays, researchers should establish standard curves using purified reaction products (if available) or develop reliable means to quantify reaction components. When measuring the transfer of phosphoglycerol residues, parallel reactions with varying enzyme concentrations should yield a proportional relationship with product formation, confirming assay linearity.

How might mdoB research contribute to antimicrobial development against Shigella infections?

Research on mdoB offers promising avenues for antimicrobial development against Shigella infections, particularly as traditional antibiotics face increasing resistance challenges . Several strategic approaches emerge from understanding mdoB function:

  • Direct enzyme inhibition:

    • High-throughput screening for small-molecule inhibitors of mdoB

    • Structure-based drug design targeting the active site

    • Allosteric inhibitors disrupting enzyme conformational changes

  • Membrane perturbation strategies:

    • Compounds that compete with natural substrates

    • Molecules that disrupt membrane-derived oligosaccharide structure

    • Agents that alter membrane composition, affecting mdoB function

  • Immunological approaches:

    • Using recombinant mdoB as part of subunit vaccine formulations

    • Targeting exposed epitopes of mdoB with antibody therapies

    • Developing diagnostics based on mdoB detection

The potential advantages of targeting mdoB include its conservation across Shigella species and critical role in membrane function. Furthermore, as mdoB functions at the bacterial membrane interface, inhibitors may face fewer barriers related to cellular penetration compared to cytoplasmic targets.

Preliminary work with chimeric proteins incorporating various Shigella antigens has shown promise in generating immune responses, suggesting that incorporating mdoB epitopes into such designs could enhance vaccine efficacy . The experimental design principles applied to other Shigella proteins could be extended to mdoB, potentially yielding immunogens with broad protection against multiple Shigella serotypes.

What comparative genomic approaches can reveal functional variations of mdoB across Shigella species?

Comparative genomic approaches offer powerful insights into functional variations of mdoB across Shigella species and related enterobacteria. Researchers should consider:

  • Phylogenetic analysis:

    • Constructing evolutionary trees of mdoB sequences across Shigella serotypes

    • Identifying selective pressure signatures in different bacterial lineages

    • Correlating sequence variations with virulence or host adaptation

  • Structural prediction and analysis:

    • Modeling mdoB proteins from different species to identify conserved domains

    • Predicting functional impact of amino acid substitutions

    • Identifying species-specific insertions/deletions that may affect function

  • Regulatory element comparison:

    • Analyzing promoter regions and transcriptional control elements

    • Identifying potential horizontal gene transfer events affecting mdoB

    • Examining operon structures containing mdoB across species

Since Shigella boydii serotype 18 was a relatively recent addition to the formal Shigella schema , comparative analysis with other S. boydii serotypes and related Shigella species can reveal evolutionary patterns and functional adaptations. This approach can identify conserved regions representing essential functional domains versus variable regions that might reflect adaptation to specific environmental niches or host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.