Recombinant Shigella boydii serotype 18 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Introduction to Shigella boydii and yciB Protein

Shigella is a genus of Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacteria that causes shigellosis in humans. First discovered in 1897, Shigella has become recognized as one of the leading bacterial causes of diarrhea worldwide, particularly affecting children in African and South Asian regions . Among the four major species (S. dysenteriae, S. flexneri, S. boydii, and S. sonnei), S. boydii serotype 18 represents an important pathogenic strain with distinct virulence characteristics.

The yciB gene encodes the Probable intracellular septation protein A, a membrane protein believed to be involved in bacterial cell division processes. While initially classified as a "probable" septation protein based on sequence homology and predicted function, recent research has begun to elucidate its precise role in bacterial physiology and pathogenesis. The recombinant form of this protein from S. boydii serotype 18 (strain CDC 3083-94 / BS512) has become an important tool for investigating bacterial membrane dynamics and potential therapeutic targets.

Role in Shigella Pathogenesis

The pathogenesis of Shigella infection involves several critical steps, including invasion of intestinal epithelial cells, escape from phagocytic vacuoles, intracellular replication, and cell-to-cell spread . While the direct contribution of yciB to these pathogenic processes has not been fully elucidated, membrane proteins like yciB are often essential for bacterial survival and adaptation during infection.

Research on Shigella has demonstrated that bacterial membrane proteins play crucial roles in the infection process. For example, certain membrane proteins contribute to the bacterium's ability to survive intracellular stress conditions, resist host defense mechanisms, and maintain cellular integrity during the dramatic environmental changes experienced throughout infection . As a membrane protein with predicted involvement in cell division, yciB may contribute to Shigella's ability to replicate within host cells, a critical aspect of its virulence.

Recent studies have highlighted the importance of metabolic adaptations in Shigella during intracellular growth. Intracellular Shigella requires specific carbon sources, particularly pyruvate, for optimal growth within host cells . Membrane proteins like yciB may play roles in the transport of essential nutrients or in maintaining cellular integrity during these metabolic adaptations.

Research Applications

Recombinant Shigella boydii yciB protein has several important research applications:

Vaccine Development

Recombinant bacterial proteins, including those from Shigella, are increasingly being investigated as potential vaccine candidates . While vaccines against Shigella remain under development, recombinant proteins like yciB provide researchers with pure antigens for immunogenicity studies and vaccine formulation research.

Antibody Production

The purified recombinant protein can be used to generate specific antibodies against yciB, which are valuable tools for studying the protein's expression, localization, and function within bacterial cells. Such antibodies can also be used for diagnostic development or for tracking bacterial infection in experimental models.

Drug Target Identification

As a membrane protein potentially involved in critical cellular processes, yciB may represent a target for novel antimicrobial compounds. The availability of the purified recombinant protein facilitates screening assays to identify molecules that interact with or inhibit the protein's function.

Comparison with yciB from Other Shigella Species

The yciB protein is conserved across different Shigella species, with high sequence similarity between variants from S. boydii, S. sonnei, and S. flexneri. This conservation suggests an important functional role for the protein. For example, the yciB protein from Shigella sonnei (UniProt ID: Q3Z0Y2) shares significant sequence homology with the S. boydii counterpart .

Comparative analysis of yciB sequences from different Shigella species may provide insights into species-specific adaptations and conserved functional domains. Such comparisons can help identify regions of the protein that are most critical for its function, potentially guiding targeted studies of protein activity or drug development efforts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please specify your preference in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the product for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; SbBS512_E1423; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Recombinant Shigella boydii serotype 18 Probable intracellular septation protein A (yciB) plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii serotype 18 and how does it relate to other Shigella species?

Shigella boydii serotype 18 is one of the four major species of the Shigella genus, which was first discovered in 1897. Shigella is a Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacteria that causes disease primarily in primates, including humans and gorillas, but not in other mammals . Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) represents one of the less common serotypes compared to S. flexneri, which accounts for approximately 60% of Shigella infections worldwide . S. boydii is typically associated with individuals who have traveled to endemic areas and is relatively rare in developed countries .

What is the typical approach for recombinant expression of Shigella boydii proteins?

Recombinant expression of Shigella boydii proteins, including those from serotype 18, typically utilizes standard prokaryotic expression systems such as E. coli, which shares high genetic similarity with Shigella . Alternative expression systems include yeast, baculovirus, or mammalian cell systems depending on the specific protein and research requirements . For intracellular proteins like yciB, optimal expression often requires careful consideration of codon optimization, fusion tags for purification, and expression conditions to maintain proper folding and functionality.

How do researchers distinguish between closely related proteins in Shigella boydii?

Researchers distinguish between related proteins in Shigella boydii through comparative bioinformatics analyses, examining amino acid sequences, conserved domains, and genetic context. For example, studies on S. flexneri identified genes that are present specifically in S. flexneri isolates but not in other Shigella species through careful bioinformatics comparisons . Researchers also use functional characterization, including gene knockout studies and complementation assays, to determine unique roles. For proteins involved in septation or intracellular growth, researchers would compare phenotypes related to cell division, morphology, and intracellular survival rates when these genes are mutated.

What specific role does the probable intracellular septation protein A (yciB) play in Shigella boydii cell division and how does it compare to similar proteins in other pathogens?

While direct information on yciB in Shigella boydii is limited in the provided sources, we can extrapolate from studies of related intracellular proteins. Septation proteins typically function in bacterial cell division processes, and in intracellular pathogens like Shigella, these proteins may have evolved additional roles related to virulence. Similar to how the intracellular growth regulator icgR affects Shigella's intracellular replication capabilities , yciB likely contributes to coordinating cell division during intracellular growth phases. Comparative analyses with homologous proteins in related pathogens would involve knockout studies, complementation experiments, and localization studies during various growth conditions, particularly during intracellular infection stages.

How does mutation or deletion of yciB affect Shigella boydii virulence and intracellular survival?

Based on findings from related studies, targeted gene deletion approaches similar to those used for icgR characterization would be appropriate for yciB functional analysis . Deletion of regulatory genes in Shigella can significantly impact virulence properties. For instance, deletion of icgR resulted in increased intracellular replication in HCT-8 cells despite showing no difference in growth under standard laboratory conditions . Similarly, knockout of YfiB, another protein involved in Shigella virulence, disrupted signaling systems and negatively affected biofilm formation, bacterial invasion, and host-surface attachment . A methodological approach to studying yciB would include creating a clean deletion mutant through double homologous recombination, followed by comprehensive phenotypic characterization including growth curves, invasion assays, intracellular replication assays, and plaque formation tests.

What methodologies are most effective for studying protein-protein interactions involving yciB in Shigella boydii?

For studying protein-protein interactions involving yciB, researchers should employ multiple complementary approaches. Pull-down assays using affinity-tagged recombinant yciB can identify binding partners in cellular lysates. Bacterial two-hybrid systems provide in vivo validation of specific interactions. For structural characterization, X-ray crystallography or cryo-electron microscopy would elucidate binding interfaces. Similar to studies on the YfiBNR system in Shigella, researchers should also consider co-immunoprecipitation followed by mass spectrometry to identify the complete interactome . Confirmation of biologically relevant interactions should be performed using fluorescence microscopy with fluorescently tagged proteins to examine co-localization during different stages of infection and cell division.

What are the optimal expression conditions for obtaining correctly folded recombinant yciB protein from Shigella boydii serotype 18?

Obtaining correctly folded recombinant yciB protein requires careful optimization of expression conditions. Since yciB is an intracellular septation protein likely associated with membranes, expression in E. coli systems with reduced induction temperatures (16-25°C) often improves folding . Consider using specialized E. coli strains designed for membrane protein expression. Fusion tags such as MBP (maltose-binding protein) or SUMO can enhance solubility while maintaining native structure. Expression in the presence of osmolytes or specific chaperones may further improve folding. Extraction should utilize mild detergents suitable for membrane-associated proteins, and proper folding can be verified through circular dichroism spectroscopy and functional assays comparing wild-type and recombinant protein activities.

How should researchers design site-directed mutagenesis experiments to identify critical amino acid residues in yciB?

Site-directed mutagenesis experiments for yciB should begin with in silico structural analysis to identify conserved domains and potential functional residues. Similar to the approach used for YfiB characterization , researchers should first generate a predicted structure through homology modeling based on related proteins with solved structures. Conserved residues across Shigella species and potential functional motifs should be prioritized for mutagenesis. Mutations should target different protein regions to assess:

  • Membrane-association domains

  • Potential protein-protein interaction interfaces

  • Conserved catalytic residues if enzymatic activity is predicted

  • Residues potentially involved in septation function

Each mutant should be evaluated through complementation studies in yciB knockout strains, assessing restoration of normal septation, cell morphology, and virulence phenotypes.

How is yciB gene expression regulated during Shigella boydii infection cycles?

Studying yciB regulation would follow approaches similar to those used for other Shigella virulence genes. Researchers should employ quantitative RT-PCR and RNA-seq to compare yciB expression levels between different growth conditions (in vitro vs. intracellular) . Based on known regulatory patterns in Shigella, one should investigate if yciB expression is controlled by established transcriptional regulators like VirF and VirB, which activate virulence genes in response to host entry . Promoter activity assays using reporter constructs can identify regulatory regions and environmental triggers affecting expression. Chromatin immunoprecipitation (ChIP) experiments would determine if specific regulators directly bind the yciB promoter region. Researchers should evaluate expression changes in response to various stressors including temperature shifts, pH changes, and exposure to host cellular factors.

What transcriptomic changes occur in Shigella boydii following yciB deletion?

To characterize transcriptomic changes following yciB deletion, researchers should perform comparative RNA-seq analysis between wild-type and ΔyciB strains under both in vitro and in vivo conditions, similar to studies performed with icgR mutants . This approach would identify genes directly or indirectly regulated by yciB. Key methodological steps include:

  • Generation of clean deletion mutants via double homologous recombination

  • RNA extraction from both laboratory culture conditions and intracellular bacteria

  • Library preparation and deep sequencing

  • Bioinformatic analysis to identify differentially expressed genes

  • Pathway enrichment analysis to determine affected cellular processes

  • Validation of key findings via qRT-PCR and phenotypic assays

What structural features distinguish yciB from other membrane-associated proteins in Shigella boydii?

Structural characterization of yciB would employ multiple complementary techniques. X-ray crystallography or cryo-electron microscopy could determine the three-dimensional structure, while membrane topology could be mapped using cysteine accessibility methods or reporter fusion approaches. Researchers should compare yciB structural features with those of homologous proteins in related bacteria, identifying conserved and divergent regions that might explain Shigella-specific functions. Biophysical techniques including circular dichroism spectroscopy, analytical ultracentrifugation, and surface plasmon resonance would characterize protein stability, oligomerization state, and binding properties. Molecular dynamics simulations could provide insights into membrane interactions and conformational changes under different conditions.

How does yciB contribute to Shigella boydii's intracellular lifestyle and bacterial septation?

To determine yciB's contribution to Shigella's intracellular lifestyle, researchers should conduct comprehensive phenotypic characterization of yciB mutants. Similar to studies on YfiB in Shigella , this would include:

  • Electron microscopy to examine septation defects and morphological changes

  • Time-lapse microscopy to observe division dynamics in live bacteria

  • Cell culture infection models to assess intracellular growth and spread

  • Tissue explant models to evaluate pathogen dissemination in more complex environments

  • Protein localization studies using fluorescent fusions to track yciB distribution during different growth phases and infection stages

Researchers should also investigate potential interactions between yciB and known virulence regulators like those in the YfiBNR signaling system or c-di-GMP pathways, which are critical for Shigella virulence regulation .

How has yciB evolved across different Shigella species and serotypes?

Evolutionary analysis of yciB would require comprehensive sequence comparison across Shigella species, serotypes, and related Enterobacteriaceae. Researchers should construct phylogenetic trees based on yciB sequences to determine conservation patterns and selective pressures. Similar to approaches used in identifying S. flexneri-specific genes , researchers should examine if yciB has undergone species-specific adaptations or horizontal gene transfer events. Evolutionary rate calculations (dN/dS ratios) would reveal if yciB is under purifying selection (conserved function) or positive selection (adaptive evolution). Comparative genomic context analysis would determine if yciB organization and adjacent genes differ between species, potentially indicating functional divergence or specialized roles in different Shigella pathovars.

What functional differences exist between yciB and its homologs in other enteric pathogens?

To characterize functional differences between yciB in S. boydii and its homologs, researchers should perform cross-species complementation experiments. This involves expressing yciB homologs from different species in a S. boydii yciB knockout and assessing restoration of function. Domain-swapping experiments, where specific regions from different homologs are exchanged, can identify domains responsible for species-specific functions. Researchers should conduct comparative infection assays in various cell types to determine if homologs differ in their abilities to support intracellular survival in different host environments. Protein interaction studies comparing the binding partners of yciB across species would reveal potential differences in interaction networks that might explain species-specific adaptations to different host environments or infection strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.