Recombinant Shigella boydii serotype 18 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
crcB; SbBS512_E0539; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the crcB gene in Shigella boydii serotype 18 and how does it compare to other Shigella species?

The crcB gene in Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) is identified by the locus tag SbBS512_E0539 and encodes a protein homolog of CrcB . This gene is part of the broader genomic diversity observed across S. boydii strains. Comparative genomic analysis has shown that S. boydii isolates separate into three distinct phylogenomic clades, each with specific gene content .

When comparing S. boydii with other Shigella species, genome analysis identified a core S. boydii genome of 2477 gene clusters present in all S. boydii genomes examined . Clade-specific genes have been identified, with S. boydii clade 1 containing 98 unique genes compared to S. boydii clades 2 and 3, which had only 4 and 12 unique genes, respectively . The unique genes include inner membrane components for transport systems and zinc-binding proteins from clade 1, several phage component proteins from clade 2, and integrase family proteins from clade 3 .

To study the genomic context of crcB in S. boydii serotype 18, researchers should employ whole genome sequencing techniques with 8-9 fold coverage, followed by assembly processing using phred/phrap program with Q20 criteria . Special attention should be paid to IS-elements to avoid mis-assembly of contigs at these loci.

What are the optimal methods for expressing and purifying recombinant Shigella boydii serotype 18 CrcB homolog protein?

Recombinant expression and purification of Shigella boydii serotype 18 CrcB homolog can be achieved through several approaches, with the following protocol recommended based on successful expression of other Shigella proteins:

Expression System Selection:
An E. coli-based expression system is typically used for recombinant Shigella proteins, as demonstrated with successful expression of other Shigella proteins such as VirGα . For CrcB homolog, consider using either BL21(DE3) pLysS or DH5α competent cells transformed with an appropriate expression vector .

Vector Construction:

  • Clone the crcB gene (SbBS512_E0539) from S. boydii serotype 18 into a high-level prokaryotic expression vector such as pRSETA, which provides a cleavable poly-histidine (6x His) tag for purification .

  • Amplify the crcB gene by PCR using appropriate primers designed to include suitable restriction sites (e.g., BamHI and EcoRI) .

  • Digest the purified PCR product and vector with appropriate restriction enzymes, followed by ligation and transformation into E. coli competent cells .

Protein Expression:

  • Culture the transformed E. coli in LB media at 37°C until OD600 reaches 0.6-0.8 .

  • Induce protein expression with IPTG (typically 0.5-1 mM) for 3-4 hours .

  • Harvest cells by centrifugation at 5,000-10,000 × g for 20-30 minutes at 4°C .

Protein Purification:

  • Resuspend cell pellet in appropriate lysis buffer containing protease inhibitors.

  • Lyse cells using sonication or alternative methods.

  • Clarify lysate by centrifugation at high speed (e.g., 20,000 × g).

  • Purify the His-tagged protein using affinity chromatography with a chelating nickel column .

  • Elute the protein with increasing concentrations of imidazole.

  • Perform dialysis to remove imidazole and other impurities.

  • Concentrate the purified protein using appropriate molecular weight cut-off filters .

Quality control should include SDS-PAGE analysis for purity assessment, western blot confirmation using anti-His antibodies, and protein concentration determination using BCA protein assay .

How does the function of CrcB homolog in Shigella boydii relate to fluoride resistance, and what experimental approaches can be used to validate this function?

The CrcB homolog in Shigella boydii is likely associated with fluoride resistance, similar to other bacterial CrcB proteins. Fluoride riboswitches (formerly called crcB RNA motifs) are conserved RNA structures identified in many bacteria and archaea and regulate the expression of downstream genes when fluoride levels are elevated . CrcB proteins are proposed to function by removing fluoride from the cell, thus mitigating the toxic effects of high fluoride levels .

Experimental Approaches to Validate CrcB Function:

  • Gene Knockout Studies:

    • Generate a crcB knockout in S. boydii using the RED recombination system of phage lambda, replacing the crcB gene with a chloramphenicol acetyltransferase (CAT) gene .

    • Design PCR primers binding to the 5' and 3' ends of the CAT gene, with each primer carrying 36 bp of S. boydii DNA flanking the crcB gene .

    • Transform the PCR product into S. boydii strain carrying pKD20, and select chloramphenicol-resistant transformants after induction of the RED genes .

    • Compare growth of wild-type and knockout strains in media containing varying concentrations of fluoride to assess differences in fluoride tolerance.

  • Complementation Assays:

    • Clone the crcB gene into an expression vector under control of an inducible promoter.

    • Transform the construct into the crcB knockout strain.

    • Test whether expression of CrcB restores fluoride resistance in the knockout strain.

  • Fluoride Transport Assays:

    • Measure intracellular fluoride levels in wild-type, knockout, and complemented strains using fluoride-specific electrodes or fluorescent probes.

    • Track changes in intracellular fluoride concentrations over time after exposure to external fluoride.

  • Gene Expression Analysis:

    • Use quantitative RT-PCR to measure expression of crcB under different fluoride concentrations.

    • Analyze expression of genes adjacent to crcB to identify potential operons.

  • Riboswitch Regulation Studies:

    • Investigate whether crcB in S. boydii is regulated by a fluoride riboswitch.

    • Create reporter gene constructs containing the putative riboswitch region to monitor gene expression in response to fluoride.

These approaches would provide comprehensive validation of the role of CrcB homolog in fluoride resistance in S. boydii serotype 18.

What is the membrane topology of CrcB homolog in Shigella boydii serotype 18, and which experimental methods are most appropriate for determining its structure?

The CrcB homolog in Shigella boydii serotype 18 (Uniprot: B2TTI6) is predicted to be a membrane protein with multiple transmembrane domains. The amino acid sequence (mLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH) suggests a hydrophobic protein consistent with membrane localization.

Recommended Methods for Structural Determination:

  • Computational Prediction:

    • Begin with hydropathy analysis and transmembrane domain prediction using software such as TMHMM, Phobius, or HMMTOP.

    • Use AlphaFold or other protein structure prediction tools to generate a preliminary structural model.

  • Experimental Topology Mapping:

    • Cysteine scanning mutagenesis: Systematically replace residues with cysteine and assess accessibility to membrane-impermeable sulfhydryl reagents.

    • Reporter fusion approach: Create fusion proteins with reporter domains (e.g., PhoA, GFP) at various positions to determine cytoplasmic vs. periplasmic localization.

    • Protease protection assays: Express the protein in membrane vesicles and assess protease accessibility of different regions.

  • Structural Biology Techniques:

    • X-ray crystallography: For crystallization, express CrcB with fusion tags that enhance solubility (e.g., MBP, SUMO) and use detergents for membrane protein solubilization.

    • Cryo-electron microscopy: Particularly useful for membrane proteins, requiring purification in detergent micelles or nanodiscs.

    • NMR spectroscopy: For specific domains or if the full protein is amenable to NMR analysis.

  • Cross-linking Studies:

    • Identify interacting residues through chemical cross-linking followed by mass spectrometry.

    • Use disulfide cross-linking with introduced cysteines to validate proximity relationships.

  • Functional Validation of Structural Elements:

    • Create targeted mutations in predicted functional domains.

    • Assess the impact on fluoride transport or resistance through in vivo or in vitro assays.

These approaches used in combination would provide comprehensive insights into the membrane topology and structure of the CrcB homolog in S. boydii serotype 18, which is critical for understanding its mechanism of fluoride transport.

What are the challenges and solutions in designing experiments to assess CrcB homolog interactions with other proteins in Shigella boydii?

Challenges in Studying CrcB Protein Interactions:

  • Membrane Protein Nature:

    • CrcB is a membrane protein, making it difficult to maintain in its native conformation during purification.

    • Traditional protein-protein interaction methods may disrupt the membrane environment critical for proper folding and function.

  • Potential Low Expression:

    • Membrane proteins often express at lower levels compared to soluble proteins.

    • The hydrophobic nature of membrane proteins can lead to aggregation or inclusion body formation during recombinant expression.

  • Specificity of Interactions:

    • Distinguishing specific from non-specific interactions with membrane proteins can be challenging.

    • The detergents used for membrane protein solubilization may disrupt weak but physiologically relevant interactions.

Methodological Solutions:

  • In vivo Interaction Approaches:

    • Bacterial Two-Hybrid System: Adapt the bacterial two-hybrid system for membrane proteins using specialized vectors designed for transmembrane proteins.

    • Protein-Fragment Complementation Assays: Use split reporter proteins (e.g., split GFP or split luciferase) fused to CrcB and potential interacting partners.

    • FRET/BRET Assays: Tag CrcB and candidate interactors with appropriate fluorescent proteins for in vivo interaction studies.

  • Membrane-Compatible Biochemical Methods:

    • Cross-linking followed by Mass Spectrometry: Use membrane-permeable cross-linkers to stabilize interactions in their native environment before analysis.

    • Co-immunoprecipitation with Membrane-Specific Detergents: Optimize detergent conditions (type and concentration) to maintain protein interactions while solubilizing membranes.

    • Blue Native PAGE: Analyze membrane protein complexes under native conditions.

  • Systems Biology Approaches:

    • Genetic Interaction Mapping: Identify synthetic lethal or synthetic rescue interactions through systematic genetic screens.

    • Transcriptional Profiling: Compare gene expression profiles between wild-type and crcB mutant strains to identify co-regulated genes that may encode interacting proteins.

  • Advanced Microscopy Techniques:

    • Super-resolution Microscopy: Track co-localization of fluorescently tagged proteins at the single-molecule level.

    • Single-Particle Tracking: Monitor the dynamics of CrcB and potential interactors in living cells.

For example, protein-protein interactions databases have been used to analyze the interaction of immune proteins in both C. elegans and humans during Shigella infection , and similar approaches could be applied to study CrcB interactions in the context of S. boydii pathogenesis.

How can I design a CRISPR-Cas9 system to edit the crcB gene in Shigella boydii serotype 18, and what are the key considerations for successful genome editing?

Designing a CRISPR-Cas9 system for editing the crcB gene in Shigella boydii serotype 18 requires careful planning. Here's a comprehensive methodological approach:

1. Design of Guide RNAs (gRNAs):

  • Obtain the complete sequence of the crcB gene (SbBS512_E0539) from S. boydii serotype 18.

  • Design multiple gRNAs targeting different regions of the crcB gene using online tools such as CHOPCHOP, CRISPR-ERA, or E-CRISP.

  • Select gRNAs with high specificity scores and low off-target potential.

  • Consider PAM requirements for the Cas9 variant being used (typically NGG for SpCas9).

  • Design gRNAs to target regions near the start codon for gene knockout or specific domains for functional studies.

2. Construction of CRISPR-Cas9 Delivery System:

  • Clone the selected gRNAs into a suitable expression vector that also encodes Cas9.

  • For Shigella, consider using a plasmid with temperature-sensitive replication and counterselectable markers to facilitate plasmid curing after editing.

  • Alternative approach: Use a two-plasmid system with Cas9 on one plasmid and the gRNA on another.

3. Design of Repair Template:

  • For knockout: Design homology arms (500-1000 bp each) flanking the target region with a selection marker in between.

  • For point mutations: Design a donor DNA with homology arms and the desired mutation, along with silent mutations in the PAM site to prevent re-cutting.

  • For gene replacement: Include the entire replacement gene flanked by appropriate homology regions.

4. Transformation Strategy:

  • Optimize electroporation conditions for S. boydii serotype 18.

  • Consider using the RED recombination system to enhance homologous recombination efficiency, similar to methods used for other genes in S. boydii .

  • Transform the CRISPR-Cas9 construct and repair template simultaneously or sequentially based on efficiency.

5. Selection and Screening:

  • Use appropriate antibiotics for primary selection based on resistance markers.

  • Design PCR primers spanning the edited region for colony screening.

  • Confirm edits by Sanger sequencing of PCR amplicons from the targeted region.

  • Verify the absence of off-target modifications in predicted off-target sites.

6. Key Considerations and Troubleshooting:

  • S. boydii contains numerous IS elements that can complicate genome editing ; design gRNAs to avoid these regions.

  • The efficiency of homologous recombination may vary across the genome; test multiple gRNAs if initial attempts fail.

  • Include controls for transformation efficiency and CRISPR cutting efficiency.

  • Consider the potential toxicity of Cas9 expression in S. boydii and use inducible promoters if necessary.

  • Verify that genetic modifications don't create polar effects on downstream genes.

7. Functional Validation:

  • Confirm changes at the protein level using western blotting or mass spectrometry.

  • Perform complementation studies to verify phenotypes are due to specific modifications.

  • Assess phenotypic changes relevant to CrcB function, such as fluoride sensitivity .

This approach integrates methodologies successfully applied to Shigella species while addressing the specific challenges of working with S. boydii serotype 18.

What is the role of CrcB homolog in Shigella pathogenesis, and how can infection models be used to study this relationship?

The role of CrcB homolog in Shigella pathogenesis is not fully characterized, but its function in fluoride resistance may contribute to bacterial survival during infection. Here we explore experimental approaches to investigate this relationship:

Potential Roles in Pathogenesis:

  • Survival in environmental niches: CrcB may help Shigella survive in fluoride-containing environments before host infection.

  • Adaptation to host defenses: CrcB could contribute to resistance against antimicrobial compounds or stress conditions encountered during infection.

  • Colonization capacity: Fluoride resistance might enhance the ability to colonize specific host tissues where fluoride is present.

Infection Models for Studying CrcB's Role:

  • Caenorhabditis elegans Infection Model:

    • C. elegans has been established as a model for S. boydii infection .

    • Compare infection outcomes between wild-type S. boydii serotype 18 and crcB mutants.

    • Methodology: Expose worms continuously to bacterial strains and monitor lifespan reduction as an indicator of pathogenicity .

    • Analyze expression of host antimicrobial genes (clec-60, clec-87, lys-7) during infection with wild-type versus crcB mutant S. boydii .

    • Use protein-protein interactions (PPIs) database to analyze the interaction of immune proteins during infection .

  • Cell Culture Models:

    • Human Colonoid Model: Use differentiated human colonoid monolayers to study Shigella adhesion and invasion .

    • Protocol:

      1. Seed colonoid fragments on human collagen IV-coated Transwell inserts and grow to confluency .

      2. Differentiate monolayers in differentiation medium without antibiotics for 5 days .

      3. Invert monolayers and place in empty 12-well tissue culture plates .

      4. Grow bacterial strains (wild-type and crcB mutants) to appropriate OD and apply to basolateral side of monolayers .

      5. For adhesion assays, incubate for 15 minutes; for invasion assays, incubate for 1.5 hours followed by gentamicin treatment .

      6. Quantify bacterial adhesion/invasion by lysing monolayers and counting CFUs .

  • Gene Expression Studies:

    • Similar to approaches used for carbon consumption regulators in S. flexneri :

      1. Generate crcB knockout strains and complemented strains.

      2. Compare virulence-associated phenotypes (attachment, invasion, plaque formation) in cell culture.

      3. Analyze expression of virulence factors in wild-type versus mutant strains.

  • Molecular Competition Assays:

    • Assess the role of CrcB in competition with host microbiota:

      1. Design co-culture experiments with commensal bacteria and S. boydii (wild-type vs. crcB mutant).

      2. Evaluate competitive fitness in the presence of different fluoride concentrations.

      3. Test whether crcB contributes to resistance against antimicrobial compounds produced by the microbiota, similar to how colicin resistance factors function in Shigella .

These approaches would provide multifaceted insights into the potential roles of CrcB homolog in S. boydii pathogenesis, from molecular mechanisms to host-pathogen interactions.

How do different phylogenomic clades of Shigella boydii vary in their crcB gene expression and function, and what methodologies can detect these differences?

The three phylogenomic clades of Shigella boydii exhibit distinct genetic content and potentially different crcB expression and function patterns . Here's a methodological framework for investigating these differences:

Comparative Genomic Analysis:

  • Sequence alignment of crcB across clades:

    • Extract and align crcB sequences from representative strains of each clade.

    • Use tools like MUSCLE, CLUSTALW, or MAFFT for alignment.

    • Identify clade-specific single nucleotide polymorphisms (SNPs) or structural variations.

  • Promoter region analysis:

    • Compare the upstream regulatory regions of crcB across clades.

    • Identify potential differences in transcription factor binding sites or riboswitch elements.

    • Use motif discovery tools (MEME, BAMM tools) to identify clade-specific regulatory elements.

  • Genomic context assessment:

    • Analyze the genes flanking crcB in different clades to identify potential operon structures or regulatory relationships.

    • Compare with core genome analysis results that identified 2477 gene clusters present in all S. boydii genomes .

Transcriptomic Analysis:

  • RNA-Seq comparison across clades:

    • Culture representative strains from each clade under identical conditions.

    • Extract RNA and perform RNA-Seq analysis.

    • Compare crcB expression levels across clades under standard conditions.

  • Response to fluoride challenge:

    • Expose strains to sublethal fluoride concentrations.

    • Use quantitative RT-PCR to measure crcB expression over time.

    • Compare the kinetics and magnitude of expression changes across clades.

  • Riboswitch functionality assessment:

    • If crcB is regulated by a fluoride riboswitch, analyze riboswitch structure and function across clades.

    • Use in-line probing or SHAPE-Seq to assess structural changes in the riboswitch RNA upon fluoride binding.

Functional Characterization:

  • Fluoride sensitivity assays:

    • Determine minimum inhibitory concentrations (MICs) of fluoride for strains from each clade.

    • Generate growth curves in the presence of various fluoride concentrations.

    • Compare recovery rates after fluoride stress.

  • Cross-complementation studies:

    • Generate crcB knockout strains in representatives of each clade.

    • Complement with crcB alleles from the same or different clades.

    • Assess whether complementation restores wild-type phenotypes equally across clades.

  • Protein localization and abundance:

    • Create translational fusions of CrcB with reporter tags (e.g., FLAG, HA).

    • Use western blotting to compare CrcB protein levels across clades.

    • Employ immunofluorescence microscopy to assess subcellular localization patterns.

Integration with Clade-Specific Characteristics:
The study by Sahl et al. identified clade-specific genes in S. boydii . Connect crcB function with:

  • Inner membrane components for transport systems unique to clade 1

  • Phage component proteins abundant in clade 2

  • Integrase family proteins specific to clade 3

This comprehensive approach would provide insights into how evolutionary divergence in S. boydii has affected crcB gene function across different phylogenomic lineages.

What bioinformatic approaches can be used to analyze the evolutionary relationship between CrcB proteins in Shigella boydii and other bacterial species?

Analyzing the evolutionary relationships of CrcB proteins requires robust bioinformatic approaches. Here's a comprehensive methodology:

1. Sequence Retrieval and Dataset Construction:

  • Obtain CrcB protein sequences from diverse sources:

    • S. boydii serotype 18 CrcB homolog (UniProt: B2TTI6)

    • CrcB sequences from other S. boydii serotypes

    • CrcB homologs from other Shigella species

    • CrcB homologs from closely related Enterobacteriaceae (E. coli, Salmonella, etc.)

    • CrcB homologs from more distant bacterial and archaeal species

  • Use databases such as UniProt, NCBI Protein, and specialized genomic databases for Enterobacteriaceae.

  • Include fluoride channel proteins (Fluc) as outgroups for comparative analysis.

2. Multiple Sequence Alignment:

  • Perform multiple sequence alignment using algorithms suitable for membrane proteins:

    • MAFFT with the L-INS-i strategy for accurate alignment

    • MUSCLE or Clustal Omega with optimized gap penalties for transmembrane regions

    • PRALINE or TM-Coffee specifically designed for transmembrane protein alignment

  • Manually inspect and refine alignments, particularly in transmembrane regions.

  • Trim alignments to remove poorly aligned regions using tools like trimAl or BMGE.

3. Phylogenetic Analysis:

  • Construct phylogenetic trees using multiple methods for robust inference:

    • Maximum Likelihood methods (RAxML, IQ-TREE) with appropriate substitution models

    • Bayesian inference (MrBayes, PhyloBayes) for posterior probability estimation

    • Distance-based methods (Neighbor-Joining) as complementary approach

  • Perform model testing to identify the optimal substitution model (e.g., using ModelTest-NG).

  • Implement bootstrapping (1000+ replicates) or posterior probability analysis to assess node support.

  • Root trees using distant homologs or midpoint rooting if appropriate outgroups are unavailable.

4. Detection of Selection Signatures:

  • Calculate dN/dS ratios to identify sites under positive, negative, or neutral selection.

  • Use methods implemented in PAML, HyPhy, or DataMonkey for selection analysis.

  • Apply branch-site models to detect lineage-specific selection patterns.

  • Correlate selection patterns with known functional domains or transmembrane regions.

5. Protein Domain and Motif Analysis:

  • Identify conserved domains and motifs across CrcB proteins using tools like HMMER, MEME, and InterProScan.

  • Map conserved residues onto predicted structural models.

  • Compare conservation patterns in fluoride-binding regions versus other structural elements.

  • Identify S. boydii-specific motifs that might relate to unique functional adaptations.

6. Horizontal Gene Transfer (HGT) Detection:

  • Use methods such as GENECONV, PhiPack, or RDP4 to detect recombination events.

  • Analyze compositional biases and codon usage patterns as indicators of HGT.

  • Construct and compare gene trees versus species trees to identify discordances suggestive of HGT.

  • Examine genomic context for evidence of mobile genetic elements.

7. Ancestral Sequence Reconstruction:

  • Infer ancestral CrcB sequences at key nodes in the phylogeny using FastML or PAML.

  • Analyze the predicted functional properties of ancestral proteins.

  • Identify key mutations that occurred during the evolution of S. boydii CrcB.

8. Comparative Genomics Analysis:

  • Analyze synteny of the crcB genomic region across species to understand evolutionary context.

  • Examine presence/absence patterns of crcB in different bacterial lineages.

  • Correlate crcB evolutionary patterns with ecological niches and habitats.

  • Relate to S. boydii's genomic organization into three distinct clades .

This comprehensive bioinformatic approach would provide a deep understanding of the evolutionary history of CrcB in S. boydii and its relationship to homologs in other bacterial species, informing functional studies and potential applications.

How can I establish a fluoride resistance assay system to evaluate the functional significance of CrcB homolog in Shigella boydii serotype 18?

Establishing a robust fluoride resistance assay system for S. boydii CrcB homolog requires careful experimental design. Here's a comprehensive methodological approach:

1. Strain Construction:

  • Generate the following strains:

    • Wild-type S. boydii serotype 18

    • crcB knockout strain using RED recombination system or CRISPR-Cas9

    • Complemented strain (crcB knockout expressing crcB from a plasmid)

    • Control strain expressing an unrelated membrane protein

    • Strains with point mutations in key residues of CrcB

2. Growth-Based Fluoride Susceptibility Assays:

a. Broth Dilution Method:
- Prepare a range of sodium fluoride (NaF) concentrations (0-100 mM) in appropriate growth media.
- Inoculate with standardized bacterial suspensions (OD600 = 0.05).
- Incubate at 37°C with shaking (180 rpm) .
- Monitor growth by measuring OD600 at regular intervals (e.g., every 30 minutes) for 24 hours.
- Determine minimum inhibitory concentration (MIC) and generate growth curves for each strain.

b. Agar Dilution Method:
- Prepare agar plates containing different concentrations of NaF.
- Spot serial dilutions (10^0 to 10^-7) of bacterial cultures.
- Incubate at 37°C for 24-48 hours.
- Compare colony formation and morphology across different strains and NaF concentrations.

c. Time-Kill Kinetics:
- Expose bacteria to lethal concentrations of NaF.
- Sample at regular intervals (0, 1, 2, 4, 8, 24 hours).
- Determine viable counts by plating on non-selective media.
- Plot survival curves to compare killing rates.

3. Fluoride Accumulation Assays:

a. Fluoride-Specific Electrode Method:
- Grow bacteria to mid-log phase.
- Expose to defined NaF concentration for various durations.
- Rapidly separate cells from media (filtration or centrifugation).
- Lyse cells and measure intracellular fluoride using a fluoride-specific electrode.
- Compare fluoride accumulation rates between wild-type and mutant strains.

b. Fluorescent Indicator Method:
- Use fluorescent indicators sensitive to fluoride (if available).
- Monitor fluorescence changes in real-time using microplate readers.
- Calculate relative fluoride uptake/efflux rates.

4. Gene Expression Analysis Under Fluoride Stress:

a. qRT-PCR:
- Expose bacteria to sublethal NaF concentrations.
- Extract RNA at different time points.
- Perform qRT-PCR targeting crcB and associated genes.
- Normalize expression using appropriate reference genes.
- Compare expression profiles across strains and conditions.

b. RNA-Seq Analysis:
- Perform global transcriptome analysis under fluoride stress.
- Identify genes co-regulated with crcB.
- Compare transcriptional responses between wild-type and crcB mutant.

5. Riboswitch Functionality Assessment:

a. Reporter Gene Assays:
- Construct fusions of the putative fluoride riboswitch upstream of crcB with reporter genes (GFP, lacZ).
- Measure reporter activity in response to varying fluoride concentrations.
- Compare wild-type riboswitch with mutated versions.

b. In-line Probing:
- Synthesize RNA containing the putative riboswitch.
- Perform in-line probing in the presence/absence of fluoride.
- Analyze structural changes indicative of riboswitch function.

6. Experimental Controls and Variables to Consider:

a. pH Control:
- Fluoride toxicity is affected by pH; maintain consistent pH across experiments.
- Include pH measurements in all assays.

b. Media Composition:
- Test fluoride resistance in different media types to assess environmental effects.
- Consider testing in minimal versus rich media.

c. Growth Phase Effects:
- Compare fluoride sensitivity in lag, exponential, and stationary phases.

d. Temperature Variables:
- Assess whether temperature affects CrcB function by testing at different temperatures.

e. Cross-Resistance:
- Test sensitivity to other toxic ions to determine specificity of CrcB function.

7. Statistical Analysis:

  • Perform at least three biological replicates for each experiment.

  • Apply appropriate statistical tests (t-test, ANOVA with post-hoc tests).

  • Calculate EC50 values for fluoride inhibition where applicable.

  • Present data with appropriate error bars and significance indicators.

This comprehensive assay system would provide robust evidence for the functional significance of CrcB homolog in fluoride resistance in S. boydii serotype 18.

What methods can be used to investigate the potential regulation of crcB gene by the fluoride riboswitch in Shigella boydii serotype 18?

Investigating the regulation of crcB by a fluoride riboswitch in S. boydii requires a multi-faceted approach combining computational, molecular, and biochemical techniques:

1. Bioinformatic Identification of Riboswitch Elements:

  • Search for fluoride riboswitch motifs (Rfam ID: RF01734) in the upstream region of crcB in S. boydii serotype 18.

  • Use tools such as Infernal, RiboScan, or the Rfam database to identify conserved structural features.

  • Compare putative riboswitch sequences with characterized fluoride riboswitches from other bacteria.

  • Perform secondary structure prediction using tools like RNAfold, Mfold, or RNAstructure.

2. Transcriptional Start Site (TSS) Mapping:

  • Perform 5' RACE (Rapid Amplification of cDNA Ends) to precisely identify the transcription start site.

  • Use RNA-seq with specialized protocols designed to capture 5' ends of transcripts.

  • Verify that the predicted riboswitch lies between the TSS and the start codon of crcB.

3. Reporter Gene Fusion Assays:

  • Construct design:

    • Clone the putative riboswitch region upstream of reporter genes (GFP, mCherry, lacZ).

    • Create a series of constructs with progressive truncations or specific mutations in the riboswitch.

    • Include positive controls (known functional fluoride riboswitches) and negative controls.

  • Reporter assays:

    • Transform constructs into S. boydii or a suitable host system.

    • Expose transformants to varying concentrations of fluoride (0-10 mM).

    • Measure reporter gene expression using appropriate detection methods (fluorescence, β-galactosidase activity).

    • Construct dose-response curves to determine the sensitivity range of the riboswitch.

4. In vitro RNA Structure and Binding Studies:

  • RNA synthesis:

    • Generate RNA transcripts containing the putative riboswitch using in vitro transcription.

    • Include variants with mutations in predicted key structural elements.

  • Structural analysis:

    • Perform in-line probing experiments to detect structural changes upon fluoride binding.

    • Use selective 2'-hydroxyl acylation analyzed by primer extension (SHAPE) to probe RNA structure with and without fluoride.

    • Consider X-ray crystallography or cryo-EM for detailed structural characterization if resources permit.

  • Binding affinity determination:

    • Use isothermal titration calorimetry (ITC) to measure fluoride binding affinity.

    • Perform electrophoretic mobility shift assays (EMSA) if structural changes are significant enough.

    • Consider surface plasmon resonance (SPR) for real-time binding kinetics.

5. In vivo Expression Analysis:

  • qRT-PCR measurement of crcB expression:

    • Expose S. boydii cultures to varying fluoride concentrations.

    • Extract RNA at different time points after exposure.

    • Perform qRT-PCR to quantify crcB transcript levels.

    • Analyze expression patterns in relation to fluoride concentration and exposure time.

  • RNA-Seq analysis:

    • Perform genome-wide transcriptional profiling under fluoride stress.

    • Compare with known fluoride-responsive genes in other bacteria.

    • Identify potential co-regulated genes that might be part of a fluoride response regulon.

6. Genetic Manipulation Experiments:

  • Generate riboswitch knockout or mutation strains using precisely targeted methods.

  • Create point mutations in critical riboswitch residues using CRISPR-Cas9 or similar approaches.

  • Compare fluoride resistance and crcB expression in wild-type versus mutated riboswitch strains.

  • Perform complementation with wild-type or mutated riboswitches to confirm functionality.

7. In-cell Structural Probing:

  • Use techniques like SHAPE-Map, DMS-MaPseq, or PARIS to probe riboswitch structure within living cells.

  • Compare riboswitch conformations in the presence and absence of fluoride in vivo.

  • Correlate structural changes with gene expression outcomes.

8. Comparative Analysis with Other Shigella Species:

  • Compare the structure and function of the fluoride riboswitch across different Shigella species and serotypes.

  • Analyze whether differences in riboswitch sequence correlate with variations in fluoride resistance.

These methods would provide comprehensive evidence for the regulation of crcB by a fluoride riboswitch in S. boydii serotype 18, characterizing both the mechanism and biological significance of this regulatory element.

How can advanced microscopy techniques be applied to study the subcellular localization and dynamics of CrcB homolog in Shigella boydii?

Advanced microscopy techniques offer powerful tools for investigating the subcellular localization and dynamics of CrcB homolog in S. boydii. Here's a comprehensive methodology:

1. Fluorescent Protein Fusion Construction:

  • Design considerations:

    • Create C-terminal and N-terminal fusions with fluorescent proteins (GFP, mCherry, mNeonGreen).

    • Use a flexible linker sequence between CrcB and the fluorescent tag to minimize interference.

    • Consider photoactivatable or photoswitchable fluorescent proteins for advanced applications.

    • Maintain native promoter control when possible to preserve physiological expression levels.

  • Validation steps:

    • Confirm that fusion proteins retain functionality through fluoride resistance assays.

    • Verify expression levels by western blotting.

    • Include control constructs with known membrane protein localizations.

2. Confocal Laser Scanning Microscopy:

  • Basic localization imaging:

    • Grow bacterial cultures to appropriate phases (exponential, stationary).

    • Image live cells using appropriate mounting techniques to minimize stress.

    • Acquire Z-stack images to capture the full 3D distribution.

    • Use membrane-specific dyes (FM4-64, DiIC18) as co-localization markers.

  • Environmental challenge imaging:

    • Image cells before and after fluoride exposure to track potential redistribution.

    • Perform time-lapse imaging during fluoride challenge to capture dynamic responses.

    • Compare localization patterns between wild-type and mutant strains.

3. Super-Resolution Microscopy Techniques:

  • Stimulated Emission Depletion (STED) Microscopy:

    • Achieve resolution below the diffraction limit (~30-80 nm).

    • Optimize labeling density and laser powers for S. boydii cell size.

    • Use dual-color STED to co-localize CrcB with other membrane components.

  • Single-Molecule Localization Microscopy (SMLM):

    • Apply techniques such as PALM (PhotoActivated Localization Microscopy) or STORM (Stochastic Optical Reconstruction Microscopy).

    • Achieve nanometer-scale precision in protein localization.

    • Analyze clustering patterns and distribution heterogeneity.

    • Consider sptPALM (single-particle tracking PALM) for mobility studies.

  • Structured Illumination Microscopy (SIM):

    • Achieve ~100 nm resolution with relatively gentle illumination.

    • Suitable for live-cell imaging over extended periods.

    • Perform 3D-SIM to resolve the membrane distribution in all dimensions.

4. Advanced Live Cell Imaging Approaches:

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Photobleach a region of CrcB-FP and monitor recovery over time.

    • Calculate diffusion coefficients and mobile/immobile fractions.

    • Compare mobility parameters before and after fluoride challenge.

  • Fluorescence Loss In Photobleaching (FLIP):

    • Continuously photobleach a region and monitor fluorescence loss elsewhere.

    • Determine connectivity of different membrane domains.

    • Assess whether CrcB forms isolated clusters or freely diffuses.

  • Fluorescence Correlation Spectroscopy (FCS):

    • Measure diffusion rates and concentration at the single-molecule level.

    • Determine whether CrcB forms oligomers under different conditions.

    • Compare diffusion characteristics with other membrane proteins.

5. Correlative Light and Electron Microscopy (CLEM):

  • Combine fluorescence microscopy with electron microscopy.

  • Locate CrcB using fluorescence, then examine the ultrastructural context with EM.

  • Utilize cryo-electron tomography for high-resolution 3D visualization of membrane protein distribution.

6. Protein-Protein Interaction Visualization:

  • Förster Resonance Energy Transfer (FRET):

    • Create pairs of fluorescent fusion proteins to detect proximity.

    • Measure interactions between CrcB subunits to assess oligomerization.

    • Investigate interactions with other membrane components.

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein between CrcB and potential interaction partners.

    • Visualize interaction sites through reconstituted fluorescence.

    • Use with inducible expression systems to control timing of interaction assays.

  • Proximity Ligation Assay (PLA):

    • Detect protein-protein interactions with antibody-based approaches.

    • Suitable for fixed cells when fluorescent fusions are not feasible.

7. Experimental Design Considerations:

  • Bacterial immobilization techniques:

    • Use agarose pads, poly-L-lysine coating, or microfluidic devices.

    • Ensure minimal stress during imaging to avoid artifacts.

  • Growth conditions:

    • Compare localization patterns under different growth phases.

    • Assess effects of osmotic stress, pH changes, and fluoride exposure.

  • Quantitative analysis:

    • Apply automated image analysis for unbiased quantification.

    • Use line-scan profiles across cells to measure membrane distribution.

    • Perform cluster analysis to identify potential functional domains.

    • Consider single-molecule tracking analysis for diffusion studies.

8. Block Design for Experimental Setup:

  • Implement a block design approach as recommended for fNIRS studies :

    • Design experiments with distinct rest and task periods.

    • Ensure sufficient duration to account for protein expression and fluoride response.

    • Keep surrounding conditions similar during rest and task periods.

    • Control for motion artifacts by minimizing sample movement.

These advanced microscopy approaches would provide unprecedented insights into the spatial organization, dynamics, and interactions of CrcB homolog in S. boydii, illuminating its functional mechanisms in fluoride resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.