Recombinant Shigella boydii serotype 18 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Biological Function

GlpG belongs to the rhomboid protease family, which cleaves transmembrane substrates within lipid bilayers. Key functional insights include:

  • Membrane Protein Quality Control: GlpG degrades orphan subunits of respiratory complexes (e.g., hydrogenase-2 and formate dehydrogenase O) to prevent cytotoxic accumulation .

  • Catalytic Mechanism: Utilizes a serine-histidine catalytic dyad (Ser201/His254 in Shigella sonnei) embedded 10 Å below the membrane surface .

  • Pathogen Persistence: In Escherichia coli, GlpG supports gut colonization by modulating fatty acid β-oxidation pathways, critical for nutrient acquisition in intestinal mucus .

Applications in Research

  • Enzymatic Studies: Used to investigate intramembrane proteolysis mechanisms .

  • Diagnostic Development: Recombinant GlpG serves as an antigen in ELISA kits for detecting Shigella infections .

  • Therapeutic Target Exploration: Inhibiting GlpG could disrupt bacterial persistence in host environments .

Genomic and Strain-Specific Context

  • Source Strain: S. boydii serotype 18 (CDC 3083-94/BS512), a clinical isolate linked to shigellosis .

  • Genomic Clustering: The glpG gene resides in the glpEGR operon, which also regulates glycerol metabolism .

  • Phylogenetic Uniqueness: S. boydii clade 1 (which includes serotype 18) harbors 98 unique genes compared to other clades, emphasizing its distinct evolutionary trajectory .

Stability and Handling

  • Shelf Life: 6 months (liquid form); 12 months (lyophilized) .

  • Usage Notes: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C retain activity for one week .

Research Gaps and Future Directions

  • Substrate Identification: Full spectrum of GlpG substrates in Shigella remains uncharacterized .

  • Structural Dynamics: How GlpG’s conformational changes regulate protease activity warrants further study .

  • Therapeutic Potential: Small-molecule inhibitors of GlpG could be explored to combat bacterial infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; SbBS512_E3806; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVVQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVVMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of glpG across Shigella species?

Rhomboid proteases like glpG are widely conserved across bacterial species and play crucial roles in various cellular processes. In Shigella species, glpG is thought to participate in membrane protein quality control, cellular signaling, and potentially in pathogenicity mechanisms. Similar rhomboid proteases in other bacterial species have been implicated in quorum sensing, biofilm formation, and virulence factor processing, suggesting comparable functions in Shigella boydii.

The conservation of glpG across Shigella serotypes indicates its fundamental importance, with serotype-specific variations potentially contributing to differences in pathogenicity profiles. Serotype 18 of S. boydii, along with serotypes 16 and 17, was added to the Shigella schema based on research demonstrating consistent biochemical reactions typical of S. boydii across strains isolated from multiple countries . This taxonomic classification provides context for understanding the evolutionary position of the serotype 18 glpG variant.

How does glpG differ between Shigella boydii serotypes?

While the search results don't provide comprehensive comparative data across all S. boydii serotypes, we can observe that both serotype 4 and serotype 18 glpG proteins are commercially available as recombinant proteins . This suggests structural and functional similarities that enable similar recombinant expression approaches. A detailed amino acid sequence comparison would reveal the extent of conservation and variation among these serotypes.

The following table illustrates a general comparison between serotype characteristics:

FeatureSerotype 4Serotype 18
Protein NameRhomboid protease glpGRhomboid protease glpG
EC Number3.4.21.1053.4.21.105
FunctionIntramembrane serine proteaseIntramembrane serine protease
Commercial AvailabilityYes Yes
Reference StrainNot specified in search resultsCDC 3083-94 / BS512

What are the challenges in expressing and purifying active recombinant glpG?

Expressing and purifying active recombinant glpG presents several significant challenges due to its nature as an intramembrane protein. Key considerations include:

  • Membrane protein solubilization: As an intramembrane protease, glpG contains hydrophobic transmembrane domains that make it difficult to express in soluble form. Researchers typically need to optimize detergent types and concentrations to maintain protein solubility while preserving native structure and activity.

  • Expression system selection: While the search results don't specify the expression system used for the commercially available recombinant S. boydii serotype 18 glpG, membrane proteins often require specialized expression systems. For comparison, the Shigella boydii dgt gene (a different protein) was successfully subcloned into a T7 RNA polymerase-based expression vector, suggesting that similar approaches might be applicable for glpG .

  • Purification strategy: Purification protocols must be carefully designed to maintain the integrity of the membrane-associated domains. For the dgt protein from S. boydii, researchers developed "a novel single-day chromatographic regime" including "ion exchange, affinity, and hydrophobic interaction chromatography" . Similar multi-step approaches would likely be necessary for glpG.

  • Protein stability: Storage conditions for recombinant S. boydii serotype 18 glpG indicate requirements for stabilization, including storage in "Tris-based buffer, 50% glycerol" at -20°C or -80°C for extended storage . These requirements highlight the potential instability of the protein under standard conditions.

How can structural studies of S. boydii serotype 18 glpG contribute to understanding bacterial pathogenicity?

Structural studies of S. boydii serotype 18 glpG have significant implications for understanding bacterial pathogenicity through several key mechanisms:

  • Substrate recognition mechanisms: Elucidating the three-dimensional structure of glpG, particularly its active site and substrate-binding regions, can reveal how this protease recognizes and processes specific membrane protein substrates. This knowledge is critical for understanding its role in bacterial physiology and potential virulence factor processing.

  • Drug target identification: Detailed structural information enables structure-based drug design approaches targeting glpG or similar rhomboid proteases. Since these proteases may be involved in pathogenicity, they represent potential targets for novel antimicrobial agents, particularly important given the rising antibiotic resistance in Shigella species.

  • Evolutionary insights: Comparing the structure of S. boydii serotype 18 glpG with rhomboid proteases from other pathogens can provide evolutionary insights into how these enzymes have adapted to different bacterial lifestyles and host environments. The addition of S. boydii serotype 18 to the Shigella schema was based on biochemical and serological studies across strains from multiple countries, indicating its global significance .

  • Pathogen-host interactions: Understanding the structure and function of glpG may reveal its potential role in host-pathogen interactions, possibly through processing of bacterial surface proteins or secreted factors that interact with host tissues.

What experimental approaches can determine the substrate specificity of S. boydii glpG?

Determining the substrate specificity of S. boydii glpG requires sophisticated experimental approaches that can account for its intramembrane localization and proteolytic activity. Recommended methods include:

  • In vitro proteolysis assays: Purified recombinant glpG can be incubated with potential substrate proteins or synthetic peptides representing transmembrane domains. Mass spectrometry analysis of cleavage products can identify specific cleavage sites and sequence preferences.

  • Substrate trapping mutants: Creating catalytically inactive mutants of glpG that can still bind but not cleave substrates allows for the identification of protein-protein interactions. These mutants can be used in pull-down assays followed by proteomic analysis to identify potential physiological substrates.

  • Comparative genomics and bioinformatics: Analysis of conserved protein targets across Shigella species and related bacteria can identify potential substrates based on sequence motifs and structural features known to be recognized by rhomboid proteases.

  • Cell-based assays: Heterologous expression systems can be used to co-express glpG with potential substrate proteins tagged for detection. Cleavage events can be monitored by western blotting or reporter systems.

  • Structural biology approaches: The structural features of glpG may provide insights into its substrate specificity. For instance, understanding the binding pocket characteristics can help predict which transmembrane domains might be recognized and cleaved.

What expression systems provide optimal yield and activity of recombinant S. boydii glpG?

While the search results don't specify the expression system used for commercially available recombinant S. boydii serotype 18 glpG, several expression systems are commonly used for membrane proteins like rhomboid proteases. Each system offers distinct advantages for expressing recombinant glpG:

  • E. coli-based expression systems: These are often the first choice due to their simplicity and high yield. For comparison, the S. boydii dgt gene was successfully expressed using a T7 RNA polymerase-based expression vector . For membrane proteins like glpG, specialized E. coli strains (C41, C43, or Lemo21) designed for membrane protein expression may be preferable.

  • Insect cell expression systems: These systems provide a eukaryotic environment that may better support proper folding and post-translational modifications of complex membrane proteins. Baculovirus-infected Sf9 or Hi5 cells often yield functional membrane proteins with native-like conformations.

  • Cell-free expression systems: These can be advantageous for membrane proteins as they allow the direct incorporation of detergents or lipids during protein synthesis, potentially enhancing proper folding of transmembrane domains.

The optimal expression system depends on research objectives:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, simple setup, cost-effectiveMay form inclusion bodies, limited post-translational modificationsStructural studies, antibody production
Insect cellsBetter folding of complex proteins, eukaryotic modificationsMore expensive, lower yield, longer timelineFunctional studies, protein-protein interactions
Cell-freeDirect incorporation of detergents/lipids, rapidExpensive, potentially lower yieldDifficult-to-express membrane proteins, rapid screening

What purification protocols yield the highest activity for recombinant S. boydii glpG?

Purifying membrane proteins like glpG while maintaining their activity requires careful consideration of detergents, buffers, and chromatography methods. Based on approaches used for similar proteins, including the purification of S. boydii dgt protein , the following multi-step protocol is recommended:

  • Membrane isolation and solubilization:

    • Extract bacterial membranes through differential centrifugation

    • Solubilize membranes using mild detergents (DDM, LMNG, or GDN)

    • Optimize detergent concentration to minimize protein denaturation

  • Initial capture and purification:

    • Utilize affinity chromatography (if the recombinant protein includes a tag)

    • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC)

    • Include low concentrations of detergent in all buffers

  • Secondary purification:

    • Ion exchange chromatography to separate based on charge properties

    • Size exclusion chromatography for final polishing and buffer exchange

    • Consider using the "novel single-day chromatographic regime" approach described for S. boydii dgt, which includes "ion exchange, affinity, and hydrophobic interaction chromatography"

  • Quality control:

    • Assess purity using SDS-PAGE

    • Verify activity using appropriate enzymatic assays

    • Analyze structural integrity using circular dichroism or thermal shift assays

Throughout the purification process, maintain the temperature at 4°C and include protease inhibitors to prevent degradation. The commercially available recombinant S. boydii serotype 18 glpG is stored in "Tris-based buffer, 50% glycerol" , suggesting that similar buffer components may be beneficial during purification to maintain stability.

What are the recommended storage conditions for maintaining long-term stability of recombinant glpG?

According to the product information for commercially available recombinant S. boydii serotype 18 glpG, the following storage conditions are recommended :

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for this protein

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C; for extended storage, conserve at -20°C or -80°C

  • Handling recommendations: "Repeated freezing and thawing is not recommended"

These conditions reflect the challenges of maintaining membrane protein stability in vitro. The high glycerol concentration (50%) acts as a cryoprotectant and helps prevent protein aggregation during freeze-thaw cycles. The recommendation against repeated freeze-thaw cycles indicates the potential sensitivity of the protein's structure to temperature fluctuations.

Researchers should consider the following additional strategies for optimal stability:

  • Aliquoting: Divide the purified protein into small single-use aliquots before freezing

  • Additives: Consider adding stabilizing agents such as reducing agents (DTT, β-mercaptoethanol) if appropriate for the intended application

  • Container material: Use low-protein-binding tubes to minimize protein loss during storage

  • Concentration: Determine the optimal protein concentration for storage (typically 1-5 mg/mL) to prevent concentration-dependent aggregation

How can the enzymatic activity of recombinant S. boydii glpG be reliably measured?

Measuring the enzymatic activity of an intramembrane protease like glpG requires specialized assays that account for its membrane-associated nature and specific proteolytic activity. Several complementary approaches are recommended:

  • Fluorogenic peptide substrates:

    • Design peptides containing a fluorophore and quencher positioned around a potential cleavage site

    • Upon cleavage by glpG, increased fluorescence can be quantitatively measured

    • Include appropriate detergents in the reaction buffer to maintain glpG in a soluble, active state

  • In vitro proteolysis of model substrates:

    • Incubate purified glpG with purified substrate proteins

    • Analyze cleavage products using SDS-PAGE, western blotting, or mass spectrometry

    • Quantify the rate of substrate disappearance or product appearance

  • Reconstitution in proteoliposomes:

    • Incorporate purified glpG into artificial liposomes to mimic its native membrane environment

    • Add fluorescently labeled substrates and monitor cleavage over time

    • This approach provides a more native-like environment for activity assessment

  • Inhibitor studies:

    • Validate activity by demonstrating inhibition with known rhomboid protease inhibitors

    • Compare activity levels with and without inhibitors under identical conditions

    • Use inhibitor studies to confirm that observed proteolytic activity is specifically due to glpG

When designing activity assays, it's important to consider the following factors:

FactorConsideration
Detergent type and concentrationMust maintain protein solubility without disrupting activity
pH and buffer compositionOptimize based on predicted physiological environment
TemperatureTypically 37°C to mimic physiological conditions
Substrate concentrationUse a range to determine kinetic parameters (Km, Vmax)
Time courseEstablish linear range of enzyme activity

How does glpG contribute to Shigella pathogenesis and potential vaccine development?

The role of glpG in Shigella pathogenesis remains an area for further investigation. Understanding its function could contribute to vaccine development strategies, particularly as researchers continue to seek effective vaccines against shigellosis. For context, Shigella infections cause approximately 160,000 deaths annually worldwide, primarily affecting children under 5 years old, and no licensed vaccine is currently available .

While the search results don't directly address glpG's role in pathogenesis, research on other Shigella proteins, such as TolC, demonstrates ongoing efforts to develop recombinant protein vaccines against Shigella species . Similar approaches could potentially be applied to glpG if it proves to be immunogenic or involved in critical virulence mechanisms.

Research questions to explore in this area include:

  • Does glpG process virulence factors required for Shigella pathogenesis?

  • Is glpG expression regulated during infection?

  • Could inhibition of glpG activity attenuate Shigella virulence?

  • Does glpG represent a potential target for novel therapeutic approaches?

What computational tools can predict glpG substrate specificity and function?

Computational approaches offer powerful methods for predicting substrate specificity and function of rhomboid proteases like glpG when experimental data is limited. Recommended computational approaches include:

  • Sequence-based predictions:

    • Multiple sequence alignment of glpG across Shigella serotypes and related bacteria

    • Identification of conserved catalytic residues and substrate-binding regions

    • Analysis of evolutionary conservation patterns to infer functional importance

  • Structural modeling:

    • Homology modeling based on known structures of bacterial rhomboid proteases

    • Molecular docking of potential substrate transmembrane domains

    • Molecular dynamics simulations to understand conformational flexibility

  • Systems biology approaches:

    • Genomic context analysis to identify functionally related genes

    • Protein-protein interaction network predictions

    • Pathway analysis to place glpG in the context of cellular processes

  • Machine learning methods:

    • Training algorithms on known rhomboid protease substrates to predict new targets

    • Feature extraction from known substrates to identify recognition patterns

    • Integration of multiple data types for improved prediction accuracy

These computational approaches can guide experimental design and help prioritize potential substrates for validation, ultimately accelerating our understanding of glpG's biological role in Shigella boydii serotype 18.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.