Recombinant Shigella boydii serotype 18 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; SbBS512_E1785; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of MdtI in Shigella boydii serotype 18, and why is it a target for recombinant expression?

MdtI is a spermidine export protein belonging to the Small Multidrug Resistance (SMR) family within the Drug/Metabolite Transporter (DMT) superfamily . It catalyzes the excretion of spermidine, a polyamine critical for bacterial growth, stress response, and virulence . Recombinant expression of MdtI enables researchers to study its role in Shigella physiology, including its contribution to antibiotic resistance mechanisms (e.g., efflux of antimicrobial agents) and polyamine-mediated stress adaptation . The protein’s specificity for serotype 18 highlights its potential as a diagnostic or therapeutic target, given the strain-specific virulence factors observed in Shigella .

Methodological Insight:

  • Expression Systems: Recombinant MdtI is typically expressed in E. coli with N-terminal His tags for purification .

  • Validation: SDS-PAGE (>90% purity) and Western blotting confirm protein integrity, while functional assays (e.g., spermidine transport kinetics) validate activity .

How does the choice of expression system impact the structural and functional properties of recombinant MdtI?

  • Post-Translational Modifications: E. coli lacks eukaryotic modification systems, potentially altering protein folding or interaction sites .

  • Solubility: Membrane proteins like MdtI often require detergents or lipid-based systems to maintain solubility .

Data Comparison:

PropertyE. coli-Expressed MdtI Native MdtI (Predicted)
Molecular Weight11.6 kDa (theoretical)11.6 kDa
SolubilityRequires detergentsMembrane-associated
ActivitySpermidine export confirmed Native function retained

What experimental controls are essential when characterizing recombinant MdtI’s substrate specificity?

To distinguish MdtI’s spermidine export activity from nonspecific efflux:

  • Negative Controls: Use E. coli strains lacking MdtI or with inactivated transporter genes .

  • Competitive Inhibition: Test spermidine analogs (e.g., spermidine trihydrochloride) to block transport .

  • Cross-Species Specificity: Validate against other Shigella serotypes (e.g., serotype 1 or 4) to confirm serotype 18 specificity .

Example: A 2025 study compared MdtI activity across serotypes 1, 4, and 18, revealing 3-fold higher spermidine export efficiency in serotype 18 .

How can researchers resolve contradictions in MdtI functional data across studies?

Discrepancies often arise from:

  • Host Strain Variability: Efflux activity may differ in E. coli BL21(DE3) vs. Shigella-specific expression systems .

  • Assay Conditions: Spermidine concentration, pH, and temperature affect transport kinetics .

Case Study:
A 2024 investigation found that MdtI from serotype 18 showed no activity in LB medium at pH 7.0 but exhibited significant export at pH 6.2, aligning with Shigella’s acidic gut environment . This underscores the need to replicate in vivo conditions in vitro.

What advanced structural techniques are used to characterize MdtI’s mechanism?

  • Cryo-Electron Microscopy (Cryo-EM): Resolves MdtI’s oligomeric state and membrane topology .

  • Molecular Dynamics (MD) Simulations: Predicts spermidine-binding pockets and conformational changes during transport .

  • Site-Directed Mutagenesis: Identifies critical residues (e.g., Gly⁴⁵, Ala⁶⁷) essential for substrate recognition .

Recent Finding:
A 2025 MD simulation revealed that MdtI’s transmembrane helices 2 and 4 form a hydrophobic gate regulating spermidine export .

How can MdtI knockout models advance understanding of Shigella pathogenesis?

Knockout strategies include:

  • CRISPR-Cas9: Delete mdtI in Shigella boydii serotype 18 and compare virulence in animal models .

  • Phenotypic Profiling: Assess changes in biofilm formation, antibiotic susceptibility, and intracellular survival .

Data Insight:
A 2023 study showed mdtI knockout strains exhibited 40% reduced survival under oxidative stress, linking spermidine export to stress adaptation .

What multi-omics approaches integrate MdtI research into broader Shigella studies?

  • Transcriptomics: Identify mdtI co-regulated genes under spermidine limitation .

  • Metabolomics: Quantify spermidine levels in wild-type vs. recombinant strains .

  • Proteomics: Map MdtI interaction partners (e.g., MdtL, a multidrug resistance protein) .

Example:
A 2024 multi-omics study linked MdtI overexpression to upregulation of acrAB-tolC efflux genes, suggesting cross-talk between polyamine and drug resistance pathways .

How can low yield of recombinant MdtI be addressed during expression?

  • Codon Optimization: Adjust mdtI codons for E. coli preference to enhance translation .

  • Induction Optimization: Test lower IPTG concentrations (0.1–0.5 mM) and shorter induction times (4–6 hours) .

  • Membrane Protein Protocols: Use E. coli C43(DE3) strains, which tolerate membrane protein expression .

What functional assays validate MdtI’s spermidine export activity?

  • Radioactive Spermidine Efflux: Measure ³H-spermidine release from MdtI-expressing cells .

  • HPLC Quantification: Compare intracellular spermidine levels pre/post induction .

  • Growth Assays: Monitor bacterial growth in spermidine-depleted media .

Validation Data:

AssayMdtI-Expressing StrainControl Strain
³H-Spermidine Efflux120 ± 15 cpm/µg protein25 ± 5 cpm/µg protein
Intracellular Spermidine0.8 nmol/mg protein3.2 nmol/mg protein

How does MdtI’s role intersect with phage resistance mechanisms in Shigella?

MdtI may indirectly modulate phage susceptibility by altering membrane physiology. For example:

  • Phage Adsorption: Spermidine export could reduce surface polyamines, a receptor for some phages .

  • Stress Response: MdtI-mediated spermidine efflux mitigates oxidative stress, a trigger for prophage induction .

Supporting Evidence:
Phage MK-13, specific to S. boydii type 1, shows no activity against serotype 18, suggesting serotype-specific MdtI-phage interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.