Recombinant Shigella boydii serotype 18 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtJ; SbBS512_E1786; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii serotype 18 and how does it relate to other Shigella species?

Shigella boydii serotype 18 is one of 20 recognized serotypes of S. boydii, a species of gram-negative bacteria that causes bacillary dysentery. While S. boydii type 12 is the most prevalent serotype (27.6%), followed by type 1 (11.7%), serotype 18 represents a smaller but significant proportion of clinical isolates . S. boydii is one of four Shigella species (alongside S. sonnei, S. flexneri, and S. dysenteriae) that cause shigellosis worldwide. Phylogenomic analysis reveals that S. boydii separates into three distinct clades, each with specific gene content, indicating substantial genomic diversity within this species . The reference strain for S. boydii serotype 18 is strain CDC 3083-94 / BS512, which was one of the first S. boydii genomes to be completely sequenced and made publicly available .

What is the function of MdtJ protein in Shigella boydii?

MdtJ (Multidrug Resistance Protein J) in S. boydii serotype 18 functions as a spermidine export protein . It belongs to the Small Multidrug Resistance (SMR) family of membrane transporters that typically contain 4 transmembrane segments. The protein plays a critical role in polyamine homeostasis by exporting excess spermidine, which can be toxic at high intracellular concentrations. MdtJ typically works in conjunction with MdtI to form a heterodimeric membrane transport complex that functions as a proton-dependent antiporter. While genomic diversity studies have identified clade-specific genes in S. boydii, including numerous transmembrane proteins in clade 1 , the specific evolutionary patterns of MdtJ across different S. boydii serotypes have not been fully characterized in the provided research.

How does the genetic structure of mdtJ in S. boydii compare to other Shigella species?

The mdtJ gene in Shigella boydii shares significant sequence homology with its counterparts in other Shigella species, including S. dysenteriae . Comparative genomic analyses have shown that the core genome of S. boydii consists of approximately 2,230 genes that are present with significant similarity across 42 examined S. boydii genomes . While the search results don't specifically address mdtJ gene structure comparisons between species, genomic analyses have revealed that S. boydii clade 1 contains 98 unique genes compared to clades 2 and 3 (which have only 4 and 12 unique genes, respectively) . These include inner membrane components for transport systems, suggesting potential variability in membrane transporters like MdtJ across different clades and species of Shigella.

What are the recommended experimental approaches for studying MdtJ function in S. boydii?

To study MdtJ function in S. boydii serotype 18, researchers should consider multiple complementary approaches:

  • Gene expression analysis: Quantitative PCR or RNA-Seq to determine expression levels of mdtJ under various environmental conditions, particularly those that affect polyamine homeostasis.

  • Protein localization studies: Fluorescent protein tagging or immunolocalization to confirm membrane localization and potential interaction with MdtI or other membrane proteins.

  • Gene knockout/complementation: CRISPR-Cas9 or homologous recombination techniques to create mdtJ deletion mutants, followed by phenotypic characterization and complementation studies.

  • Transport assays: Using radiolabeled or fluorescently labeled spermidine to measure export activity in wild-type versus mutant strains.

  • Recombinant protein analysis: Expression of recombinant MdtJ for structural studies and in vitro reconstitution of transport activity .

When using recombinant MdtJ protein, researchers should validate its functionality through transport assays in reconstituted proteoliposomes or by complementation of mdtJ mutants to ensure the recombinant protein maintains native functionality.

How can recombinant MdtJ protein be effectively used in Shigella pathogenesis research?

Recombinant MdtJ protein can be utilized in multiple ways to advance understanding of Shigella pathogenesis:

  • Antibody development: Purified recombinant MdtJ can be used to generate specific antibodies for detection and quantification of native MdtJ expression during infection.

  • Host-pathogen interaction studies: Investigating whether MdtJ-mediated polyamine export affects host cell responses during infection, particularly innate immune responses that may be modulated by polyamines.

  • Bacterial stress response: Examining how MdtJ contributes to bacterial survival under host-imposed stresses, such as oxidative stress or antimicrobial peptide exposure.

  • Biofilm formation: Assessing the role of MdtJ and polyamine homeostasis in biofilm development, which may contribute to environmental persistence and transmission.

  • Drug target validation: Utilizing recombinant MdtJ in high-throughput inhibitor screening to identify compounds that could disrupt polyamine homeostasis and potentially serve as novel antimicrobials.

By integrating findings from these approaches with genomic analyses that have characterized the diversity of S. boydii , researchers can contextualize MdtJ function within the broader landscape of Shigella virulence mechanisms.

What controls should be included when working with recombinant S. boydii MdtJ protein in experimental setups?

When designing experiments with recombinant S. boydii serotype 18 MdtJ protein, the following controls should be incorporated:

  • Negative controls:

    • Empty vector expression (for expression systems)

    • Heat-inactivated recombinant MdtJ (to confirm activity is protein-specific)

    • Unrelated membrane protein of similar size (to control for non-specific effects)

  • Positive controls:

    • Known functional homologs (e.g., MdtJ from E. coli or S. dysenteriae )

    • Previously validated transport substrates

  • Experimental validation controls:

    • Western blotting to confirm protein expression and purity

    • Circular dichroism to verify proper protein folding

    • Liposome incorporation assays to ensure membrane integration

    • Transport assays with varying substrate concentrations to establish kinetic parameters

  • Specificity controls:

    • Multiple serotypes of S. boydii (beyond serotype 18) to evaluate serotype-specific differences

    • Testing with phylogenetically distinct clades as identified in genomic analyses

    • Competition assays with known substrates and structural analogs

What are the common challenges in expressing and purifying recombinant MdtJ protein?

Expressing and purifying membrane proteins like MdtJ presents several challenges:

  • Expression challenges:

    • Toxicity to expression host due to membrane disruption

    • Inclusion body formation leading to misfolded protein

    • Low expression levels due to codon bias or toxic effects

  • Purification challenges:

    • Maintaining protein stability during solubilization

    • Selecting appropriate detergents that preserve native conformation

    • Preventing aggregation during concentration steps

    • Removing host cell membrane proteins that co-purify

  • Troubleshooting strategies:

    • Using specialized expression systems designed for membrane proteins

    • Optimizing growth temperature, inducer concentration, and induction timing

    • Employing fusion tags that enhance solubility or facilitate purification

    • Testing multiple detergent conditions for optimal extraction and stability

    • Considering native-like environments such as nanodiscs or amphipols for final protein storage

For MdtJ specifically, co-expression with its partner protein MdtI may improve folding and stability, as these proteins typically function as heterodimers in their native context.

How can researchers validate the biological activity of recombinant MdtJ protein?

Validating the biological activity of recombinant MdtJ requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Size exclusion chromatography to verify oligomeric state

    • Thermal shift assays to assess protein stability

  • Functional validation:

    • Reconstitution into proteoliposomes for transport assays

    • Substrate binding assays using fluorescence-based techniques

    • Electrode-based methods to measure proton-coupled transport

  • Complementation assays:

    • Introduction of recombinant MdtJ into mdtJ knockout strains

    • Assessment of phenotype restoration, particularly under conditions where polyamine export is critical

    • Measurement of intracellular polyamine levels to confirm transport function

  • Interaction studies:

    • Co-immunoprecipitation with known partners (e.g., MdtI)

    • Biolayer interferometry or surface plasmon resonance to quantify binding to substrates or inhibitors

These validation steps ensure that recombinant MdtJ retains both structural integrity and functional capabilities representative of the native protein.

What are the best methods for detecting expression of native MdtJ in S. boydii samples?

Several approaches can be employed to detect native MdtJ expression in S. boydii samples:

  • Transcriptional analysis:

    • Quantitative RT-PCR targeting mdtJ mRNA

    • RNA-Seq for genome-wide expression analysis, including mdtJ

    • Northern blotting for direct visualization of mdtJ transcript

  • Protein detection:

    • Western blotting using antibodies generated against recombinant MdtJ

    • Mass spectrometry of membrane fractions

    • Immunofluorescence microscopy to visualize cellular localization

  • Reporter systems:

    • Transcriptional fusions (mdtJ promoter driving reporter gene expression)

    • Translational fusions (MdtJ-reporter protein chimeras)

  • Comparative approaches:

    • Analysis across multiple serotypes to assess variability in expression levels

    • Examination of expression in different phylogenomic clades of S. boydii

    • Comparison with expression patterns in other Shigella species

For diagnostic purposes in clinical samples, a combination of molecular and serological methods may be necessary, similar to the phage-based approaches developed for serotype identification of S. boydii type 1 .

How does the evolutionary conservation of MdtJ across S. boydii clades inform our understanding of its functional importance?

Evolutionary conservation analysis of MdtJ across the three identified S. boydii phylogenomic clades provides valuable insights into its functional significance:

  • Conservation patterns:

    • Analysis of selective pressure on the mdtJ gene sequence (dN/dS ratios)

    • Identification of highly conserved domains versus variable regions

    • Mapping of conservation onto predicted structural models

  • Clade-specific variations:

    • Examination of whether MdtJ belongs to the core genome of 2,230 genes shared across S. boydii isolates

    • Assessment of whether MdtJ shows clade-specific variations similar to other membrane transporters

    • Analysis of whether MdtJ is among the 98 unique genes in clade 1 or the fewer unique genes in clades 2 and 3

  • Functional implications:

    • Correlation between sequence conservation and functional domains

    • Investigation of whether sequence variations correlate with differences in substrate specificity

    • Examination of co-evolution with interacting partners such as MdtI

  • Evolutionary context:

    • Comparison with homologs in other Shigella species and E. coli

    • Analysis of horizontal gene transfer events that may have shaped mdtJ evolution

    • Investigation of potential selective pressures in different host environments

Understanding these evolutionary patterns could identify critical functional regions that might serve as targets for antimicrobial development or diagnostic tools.

What is the relationship between MdtJ function and antimicrobial resistance in S. boydii?

The relationship between MdtJ function and antimicrobial resistance represents an important area for investigation:

  • Direct resistance mechanisms:

    • Evaluation of whether MdtJ can export antimicrobial compounds in addition to its canonical spermidine substrate

    • Investigation of whether overexpression of MdtJ confers resistance to specific classes of antibiotics

    • Assessment of MdtJ expression levels in drug-resistant versus susceptible isolates

  • Indirect resistance contributions:

    • Examination of how polyamine homeostasis maintained by MdtJ affects bacterial stress responses

    • Investigation of whether MdtJ-mediated polyamine export modulates biofilm formation, which can contribute to antibiotic tolerance

    • Study of interactions between polyamine metabolism and other resistance mechanisms

  • Regulatory connections:

    • Analysis of whether stress response regulators or antibiotic resistance regulatory networks influence mdtJ expression

    • Investigation of potential co-regulation with established resistance determinants

  • Clinical correlations:

    • Examination of mdtJ expression or sequence variations in clinical isolates with different antimicrobial susceptibility profiles

    • Assessment of whether targeting MdtJ could enhance efficacy of existing antibiotics

This research direction aligns with WHO priorities for research and development of new drugs against Shigella , as novel targets and approaches are needed to address increasing antimicrobial resistance.

How might differential expression of MdtJ across S. boydii serotypes contribute to serotype-specific virulence patterns?

The potential contribution of MdtJ to serotype-specific virulence patterns in S. boydii warrants comprehensive investigation:

  • Expression profiling:

    • Comparative analysis of mdtJ expression levels across different serotypes

    • Examination of expression during different stages of infection

    • Investigation of serotype-specific regulatory mechanisms controlling mdtJ expression

  • Serotype-specific interactions:

    • Assessment of whether MdtJ interacts with different partners in various serotypes

    • Investigation of potential serotype-specific post-translational modifications

    • Examination of membrane microdomain localization across serotypes

  • Functional consequences:

    • Comparison of polyamine export efficiency between serotypes

    • Assessment of whether serotype-specific variations affect substrate specificity

    • Investigation of host cell responses to different serotype variants of MdtJ

  • Virulence correlations:

    • Analysis of whether MdtJ variation correlates with documented differences in virulence between serotypes

    • Examination of potential associations between MdtJ function and clinical severity

    • Investigation of interactions with known virulence factors that may differ across serotypes

This research could provide insights into why certain serotypes of S. boydii are more prevalent in clinical settings, such as the predominance of serotype 12 (27.6%) compared to serotype 18 , and potentially inform serotype-specific intervention strategies.

What bioinformatic approaches are most effective for analyzing MdtJ sequence and structural characteristics?

To comprehensively analyze MdtJ sequence and structural characteristics, researchers should employ a multi-layered bioinformatic approach:

  • Sequence analysis:

    • Multiple sequence alignment of MdtJ across Shigella species and serotypes

    • Phylogenetic tree construction to visualize evolutionary relationships

    • Identification of conserved motifs and functional domains

    • Prediction of transmembrane segments and topology

  • Structural prediction:

    • Homology modeling based on structurally characterized SMR family proteins

    • Ab initio modeling for regions lacking homologous structures

    • Molecular dynamics simulations to assess conformational flexibility

    • Docking studies with known substrates and potential inhibitors

  • Functional annotation:

    • Gene neighborhood analysis to identify conserved operonic structures

    • Prediction of protein-protein interaction networks

    • Identification of potential regulatory elements in the promoter region

    • Comparison with experimentally characterized homologs

  • Integrative approaches:

    • Combination of whole genome sequence data from the phylogenomic clades identified in S. boydii

    • Integration with transcriptomic data when available

    • Correlation of sequence variations with phenotypic differences

    • Meta-analysis of MdtJ characteristics across the Enterobacteriaceae family

These bioinformatic approaches should be iteratively refined based on experimental validation to enhance prediction accuracy and functional insights.

How can researchers effectively study the role of MdtJ in host-pathogen interactions during S. boydii infection?

Investigating MdtJ's role in host-pathogen interactions requires a comprehensive experimental toolkit:

  • Infection models:

    • Cell culture systems (intestinal epithelial cells, macrophages)

    • Organoid models that recapitulate intestinal architecture

    • Animal models of shigellosis (when ethically approved)

    • Ex vivo intestinal tissue explants

  • Genetic approaches:

    • Construction of mdtJ deletion and point mutants in S. boydii

    • Complementation with wild-type and modified mdtJ variants

    • Inducible expression systems to control timing of MdtJ expression

    • Reporter fusions to monitor mdtJ expression during infection

  • Host response assessment:

    • Transcriptomic analysis of host cells infected with wild-type versus mdtJ mutants

    • Measurement of inflammatory cytokine production

    • Evaluation of antimicrobial peptide resistance

    • Analysis of polyamine levels in infected host cells

  • Advanced imaging techniques:

    • Live cell imaging to track bacterial behavior during infection

    • Super-resolution microscopy to visualize MdtJ localization

    • Correlative light and electron microscopy to associate MdtJ with ultrastructural features

    • FRET-based approaches to detect protein-protein interactions in situ

These approaches should be conducted with appropriate controls and across multiple serotypes to identify serotype-specific versus conserved aspects of MdtJ function during infection.

What experimental design considerations are essential when comparing MdtJ function across different S. boydii phylogenomic clades?

When designing experiments to compare MdtJ function across the three S. boydii phylogenomic clades identified through genomic analyses , researchers should consider the following experimental design elements:

  • Strain selection:

    • Include representative isolates from each of the three phylogenomic clades

    • Select strains with well-characterized genomes and virulence phenotypes

    • Consider including the reference strain CDC 3083-94 / BS512 (serotype 18)

    • Include sufficient biological replicates within each clade to account for intra-clade variation

  • Standardized methodologies:

    • Employ identical culture conditions, growth phases, and experimental procedures across all strains

    • Use standardized assays for measuring MdtJ expression and function

    • Develop identical genetic manipulation protocols that work across clades

    • Apply consistent analytical approaches to all datasets

  • Multilevel analysis:

    • Compare mdtJ sequence variations at nucleotide and amino acid levels

    • Assess transcriptional regulation under identical conditions

    • Evaluate protein expression, localization, and interaction partners

    • Measure functional outputs (e.g., polyamine transport capacity)

  • Contextual interpretation:

    • Relate MdtJ variations to broader genomic differences between clades

    • Consider how clade-specific gene content (98 unique genes in clade 1 versus fewer in clades 2 and 3) might influence MdtJ function

    • Examine potential epistatic interactions within each clade's genetic background

    • Interpret findings in the context of clinical and epidemiological data for each clade

This systematic approach will help distinguish clade-specific characteristics from general properties of MdtJ and provide insights into the functional evolution of this protein within the S. boydii species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.