Recombinant Shigella boydii serotype 18 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; SbBS512_E0911; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
msrQ
Target Protein Sequence
MRLTAKQVTWLKVSLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLRSLFNRLRKQVHNKLSV
Uniprot No.

Target Background

Function
This protein is part of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This mechanism protects these proteins from oxidative-stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. This includes the primary periplasmic chaperone SurA and the lipoprotein Pal. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant YedZ typically produced for research purposes?

Recombinant YedZ is commonly expressed in E. coli expression systems. The full-length protein (1-211 amino acids) is often fused to an N-terminal His-tag to facilitate purification. After expression, the protein is typically purified using affinity chromatography, yielding a product with greater than 90% purity as determined by SDS-PAGE. The purified protein is generally supplied as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What are the optimal storage and reconstitution conditions for recombinant YedZ?

For storage:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration recommended: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

What is the predicted membrane topology of YedZ and how does it relate to its function?

YedZ is predicted to be a membrane-spanning protein with several transmembrane domains, as suggested by the hydrophobic stretches in its amino acid sequence. These membrane-spanning regions are critical for its proper localization and function. The protein contains heme-binding domains that are essential for its role in sulfoxide reduction. The membrane orientation allows YedZ to interact with both cytoplasmic and periplasmic components, facilitating electron transfer across the membrane during redox reactions .

How does YedZ interact with other components of the sulfoxide reduction pathway?

As a heme-binding subunit (MsrQ), YedZ likely functions as part of a larger sulfoxide reductase complex. It is believed to interact with MsrP (the soluble catalytic component) and potentially other redox proteins. The heme group in YedZ serves as an electron transfer intermediary, accepting electrons from electron donors and transferring them to the catalytic subunit for the reduction of oxidized substrates. This system helps protect bacterial proteins from oxidative damage, particularly the oxidation of methionine residues to methionine sulfoxide, which can impair protein function .

What structural features distinguish YedZ from similar proteins in other Shigella serotypes or related bacteria?

While YedZ is conserved across many Enterobacteriaceae, the Shigella boydii serotype 18 variant has specific amino acid substitutions that may influence its substrate specificity or redox potential. Comparative sequence analysis with YedZ homologs from other Shigella species or E. coli reveals conserved heme-binding motifs but potential differences in membrane-spanning domains. These differences could contribute to serotype-specific differences in oxidative stress responses or virulence. Structural analyses using techniques like X-ray crystallography or cryo-EM would be valuable for identifying these distinguishing features in detail .

What are the recommended protocols for assessing YedZ enzymatic activity in vitro?

For measuring YedZ activity as part of the sulfoxide reductase system:

  • Coupled enzyme assay:

    • Reconstitute purified YedZ in a suitable membrane-mimicking environment (liposomes or detergent micelles)

    • Add purified MsrP (the catalytic subunit)

    • Use methionine sulfoxide as substrate and monitor its reduction to methionine

    • Detection can be achieved through HPLC separation of substrate and product

    • Alternatively, use a coupled assay with NADPH as electron donor and measure NADPH oxidation spectrophotometrically at 340 nm

  • Heme-binding assessment:

    • Measure the UV-visible absorption spectrum of purified YedZ (peaks at approximately 410 nm for oxidized heme)

    • Perform redox titrations to determine the midpoint potential of the heme cofactor

    • Use circular dichroism to assess protein folding and stability

  • Electron transfer kinetics:

    • Employ stopped-flow spectroscopy to measure real-time electron transfer rates

    • Use physiological electron donors and acceptors to reconstruct the complete electron transfer pathway

What approaches can be used to study YedZ localization and expression in Shigella boydii?

Multiple complementary techniques can be employed:

  • Immunofluorescence microscopy:

    • Generate specific antibodies against YedZ or use anti-His antibodies for tagged constructs

    • Fix and permeabilize bacterial cells

    • Perform immunostaining and visualize using confocal microscopy

    • Co-localization studies with membrane markers can confirm membrane localization

  • Subcellular fractionation:

    • Separate bacterial membrane fractions (inner vs. outer membrane)

    • Analyze fractions by Western blotting to detect YedZ

    • Compare with known marker proteins for different cellular compartments

  • Reporter gene fusions:

    • Create transcriptional or translational fusions with reporter genes (GFP, etc.)

    • Monitor expression under different growth conditions

    • Identify factors that regulate YedZ expression

  • Quantitative RT-PCR:

    • Design specific primers for yedZ gene

    • Extract RNA from bacteria grown under various conditions

    • Quantify yedZ mRNA levels to assess transcriptional regulation

How can researchers effectively create and validate YedZ knockout mutants in Shigella boydii?

A systematic approach includes:

  • Gene deletion strategy:

    • Use lambda Red recombination system similar to what has been described for other Shigella genes

    • Design primers with homology to regions flanking yedZ gene and a selectable marker (e.g., chloramphenicol acetyltransferase gene)

    • Transform the PCR product into Shigella boydii carrying the pKD20 plasmid

    • Select for antibiotic-resistant transformants after induction of RED genes

    • Verify deletion by PCR and sequencing

  • Complementation analysis:

    • Clone the wild-type yedZ gene into an expression vector

    • Transform the construct into the yedZ knockout strain

    • Verify expression of the complemented gene by Western blotting

    • Assess whether complementation restores wild-type phenotypes

  • Phenotypic characterization:

    • Compare growth rates under normal and oxidative stress conditions

    • Assess sensitivity to oxidizing agents (H₂O₂, methionine sulfoxide, etc.)

    • Measure virulence properties using appropriate infection models

    • Analyze global changes in protein oxidation states using proteomic approaches

What is the potential of YedZ as a vaccine antigen against Shigella infection?

While YedZ itself has not been extensively studied as a vaccine candidate, lessons from other Shigella protein antigens provide valuable insights:

  • Conservation analysis:

    • YedZ is relatively conserved across Shigella species and serotypes

    • This conservation could potentially make it a candidate for broad-spectrum protection

    • Compare YedZ sequence homology across multiple Shigella strains to assess conservation level

  • Immunogenicity assessment:

    • Evaluate antibody responses to YedZ in naturally infected humans or experimental animals

    • Determine if anti-YedZ antibodies neutralize bacterial functions or promote opsonization

    • Investigate T-cell responses to YedZ epitopes

  • Protective capacity:

    • Test purified recombinant YedZ as a subunit vaccine in animal models

    • Evaluate different adjuvants and delivery systems

    • Compare protection against homologous and heterologous Shigella challenges

How does YedZ expression change during different stages of Shigella infection?

Understanding YedZ regulation during infection:

  • In vitro infection models:

    • Infect human intestinal epithelial cell lines with Shigella boydii

    • Collect samples at different time points post-infection

    • Measure yedZ gene expression using qRT-PCR

    • Perform Western blotting to quantify protein levels

  • Animal infection studies:

    • Use appropriate animal models such as the mouse model described in the search results

    • Collect bacteria from infected tissues at various stages

    • Analyze yedZ expression in bacteria recovered from different host compartments

    • Compare with in vitro grown bacteria to identify infection-specific regulation

  • Environmental cues:

    • Investigate how yedZ expression responds to host-related signals:

      • Low iron conditions (using iron chelators)

      • Oxidative stress (H₂O₂ exposure)

      • pH changes

      • Bile salts and other intestinal factors

How can YedZ be incorporated into chimeric protein constructs for enhanced vaccine efficacy?

Building on approaches used for other Shigella antigens:

  • Epitope identification:

    • Map immunodominant B-cell and T-cell epitopes within YedZ

    • Identify surface-exposed regions most likely to induce protective antibodies

    • Use computational analysis and experimental validation

  • Chimeric design strategies:

    • Combine YedZ epitopes with other protective Shigella antigens (IpaB, IpaD, VirG, etc.)

    • Use flexible linkers to ensure proper folding of each component

    • Consider fusion with molecular adjuvants or targeting molecules

  • Expression and purification optimization:

    • Test different expression systems (E. coli, cell-free systems)

    • Optimize codon usage for maximal expression

    • Develop purification protocols to ensure high yield and purity

    • Validate protein structure using circular dichroism or other techniques

  • Immunological evaluation:

    • Assess humoral and cellular immune responses to the chimeric construct

    • Compare with individual components to demonstrate enhanced immunogenicity

    • Evaluate protective efficacy in appropriate animal models

What role does YedZ play in Shigella's oxidative stress response and how does this contribute to pathogenesis?

As a sulfoxide reductase component, YedZ likely contributes to bacterial defense against oxidative stress:

  • Oxidative stress resistance:

    • Compare survival of wild-type vs. YedZ-deficient Shigella under various oxidizing conditions

    • Measure intracellular reactive oxygen species (ROS) levels using fluorescent probes

    • Analyze oxidized protein profiles using proteomic approaches (OxyBlot, mass spectrometry)

  • Host-pathogen interface:

    • Investigate YedZ's role in countering host-generated ROS during infection

    • Assess phagocyte killing of YedZ-deficient vs. wild-type bacteria

    • Examine bacterial survival within macrophages and neutrophils

  • Virulence regulation:

    • Study how oxidative stress sensing via YedZ might regulate virulence gene expression

    • Perform RNA-seq comparing wild-type and YedZ-deficient strains under various conditions

    • Identify regulatory networks connecting redox sensing to virulence mechanisms

How do structural variations in YedZ across different Shigella species affect its enzymatic properties and potential as a drug target?

Understanding structure-function relationships:

  • Comparative structural analysis:

    • Model YedZ structures from different Shigella species using homology modeling

    • Identify key differences in amino acid residues near functional domains

    • Perform molecular dynamics simulations to predict effects on protein dynamics

  • Functional consequences:

    • Express and purify YedZ variants from different species

    • Compare enzymatic parameters (Km, kcat, substrate preference)

    • Assess stability and heme-binding properties

  • Drug targeting potential:

    • Identify potential binding pockets for small molecule inhibitors

    • Perform virtual screening against these pockets

    • Validate hits with binding assays and functional inhibition tests

    • Evaluate species-specificity of inhibitors

What is the complex interplay between iron availability, YedZ function, and Shigella virulence?

Given YedZ's role as a heme-containing protein and the importance of iron in Shigella infection:

  • Iron-dependent regulation:

    • Analyze yedZ expression under iron-replete and iron-limited conditions

    • Identify potential iron-responsive regulatory elements in the yedZ promoter

    • Investigate regulation by iron-responsive transcription factors

  • Heme acquisition and incorporation:

    • Study how Shigella acquires heme for YedZ under host conditions

    • Investigate the machinery for heme incorporation into YedZ

    • Assess the impact of heme biosynthesis inhibitors on YedZ function

  • Connection to virulence:

    • Examine how iron supplementation affects YedZ function and bacterial virulence

    • Use the newly developed iron-dependent mouse model to investigate YedZ's role

    • Compare effects in wild-type mice versus those with altered iron status

    • Correlate findings with human infection scenarios where iron status varies

TechniqueApplication to YedZ ResearchExpected Outcome
X-ray CrystallographyDetermine 3D structureHigh-resolution structural data revealing heme-binding pocket and membrane topology
Electron Paramagnetic ResonanceAnalyze heme environmentInformation on redox state, ligand binding, and electronic structure
HDX-MSMap protein dynamicsIdentification of flexible regions and interaction interfaces
Genetic ComplementationValidate functionConfirmation of specific amino acid residues critical for activity
RNA-SeqStudy regulationTranscriptional networks controlling YedZ expression
Cryo-EMVisualize protein complexesStructure of YedZ in complex with partner proteins
Animal Infection ModelsAssess in vivo relevanceRole of YedZ in colonization, inflammation, and disease progression

What strategies can address poor expression or solubility of recombinant YedZ?

As a membrane protein, YedZ presents particular challenges for recombinant expression:

  • Expression optimization:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3) - specialized for membrane proteins)

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Consider auto-induction media for gentler expression

    • Try specialized expression vectors with tunable promoters

  • Solubilization approaches:

    • Screen different detergents for membrane extraction (DDM, LDAO, FC-12)

    • Test detergent-to-protein ratios systematically

    • Consider native nanodiscs or amphipols for maintaining structure

    • Evaluate membrane scaffold proteins or liposome reconstitution

  • Fusion partners:

    • Test fusion with solubility-enhancing tags (MBP, SUMO, TrxA)

    • Incorporate optimized signal sequences for proper membrane targeting

    • Consider truncation constructs if full-length proves challenging

How can researchers troubleshoot inconsistent results in YedZ activity assays?

Several factors can affect enzymatic assays of membrane proteins:

  • Protein quality assessment:

    • Verify proper folding using circular dichroism or fluorescence spectroscopy

    • Confirm heme incorporation by UV-visible spectroscopy (characteristic Soret band)

    • Check for aggregation using dynamic light scattering

    • Assess purity by SDS-PAGE and size exclusion chromatography

  • Assay optimization:

    • Control buffer conditions carefully (pH, ionic strength, reducing agents)

    • Optimize detergent concentration to maintain activity while preventing aggregation

    • Ensure all components of electron transfer chain are present and active

    • Use appropriate controls for background activity and non-enzymatic reactions

  • Stability considerations:

    • Monitor activity over time to assess stability

    • Identify and control factors leading to inactivation

    • Consider adding stabilizing agents (glycerol, specific lipids)

    • Optimize storage conditions to maintain consistent activity

What are the key considerations when designing knockout or mutation studies targeting YedZ in Shigella?

Several potential challenges require careful planning:

  • Genetic manipulation considerations:

    • Account for potential polar effects on neighboring genes

    • Design clean deletion strategies that don't disrupt operon structure

    • Consider conditional knockout approaches if YedZ is essential

    • Verify genotype by sequencing and phenotype by complementation

  • Functional validation:

    • Include appropriate controls (wild-type, complemented mutant)

    • Perform comprehensive phenotypic analysis under multiple conditions

    • Consider compensatory mechanisms that might mask phenotypes

    • Use sensitive assays specific for YedZ function

  • Experimental design for in vivo studies:

    • Select appropriate infection models that reflect YedZ's physiological role

    • Control for variations in bacterial fitness that might confound results

    • Consider mixed infections (wild-type vs. mutant) to increase sensitivity

    • Plan appropriate sample sizes based on expected effect magnitudes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.