Recombinant Shigella boydii serotype 18 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate your preference, and we will prioritize developing the specified tag.
Synonyms
uspB; SbBS512_E3828; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii serotype 18 Universal stress protein B (uspB) and what is its significance in research?

Universal stress protein B (uspB) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) is a bacterial stress response protein that plays a role in bacterial adaptation to environmental stressors. Shigella, first discovered in 1897, is a genus of Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacteria that causes disease primarily in primates including humans . The uspB protein is part of the bacterial stress response system that helps the pathogen survive under adverse conditions.

Research on uspB is significant because Shigella is one of the leading bacterial causes of diarrhea worldwide, particularly affecting children in Africa and South Asia . Understanding the stress response mechanisms of this pathogen can provide insights into its survival strategies and potentially lead to new therapeutic approaches. The recombinant form of this protein allows for controlled study in laboratory settings.

What expression systems are most effective for producing recombinant Shigella boydii uspB?

Recombinant Shigella boydii uspB can be produced using several expression systems, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsBest Application
E. coliHigh yield, cost-effective, rapid growthPotential endotoxin contaminationBasic functional studies, antibody production
YeastPost-translational modifications, secretionSlower growth than E. coliStructural studies requiring glycosylation
BaculovirusComplex protein folding, higher eukaryotic PTMsMore complex system, higher costProtein-protein interaction studies
Mammalian CellNative-like folding and modificationsLowest yield, highest costFunctional assays requiring mammalian conditions

What purification strategies are recommended for recombinant uspB protein?

For effective purification of recombinant uspB from Shigella boydii serotype 18, a multi-step approach is recommended:

  • Initial Clarification: After cell lysis, centrifugation at 10,000-15,000 × g for 30 minutes to remove cell debris.

  • Affinity Chromatography: If using a tagged construct (His-tag is common), immobilized metal affinity chromatography (IMAC) provides high selectivity for the target protein.

  • Ion Exchange Chromatography: Based on the theoretical pI of uspB, select an appropriate ion exchange medium (anion or cation exchange).

  • Size Exclusion Chromatography: As a polishing step to remove aggregates and ensure uniform protein species.

  • Endotoxin Removal: Critical for proteins expressed in E. coli systems, particularly if downstream applications involve immunological studies.

To validate purity, researchers should employ SDS-PAGE with Coomassie staining (target >95% purity) and Western blotting with anti-uspB antibodies for specificity confirmation.

How can researchers verify the identity and integrity of purified recombinant uspB?

Verification of recombinant uspB identity and integrity requires multiple analytical approaches:

  • Mass Spectrometry: Peptide mass fingerprinting following tryptic digestion to confirm protein identity.

  • N-terminal Sequencing: Edman degradation to verify the correct N-terminal sequence.

  • Circular Dichroism (CD): To assess secondary structure elements and confirm proper folding.

  • Dynamic Light Scattering (DLS): To evaluate size distribution and detect potential aggregation.

  • Functional Assays: Activity-based assays specific to uspB function, such as stress response induction in cellular models.

For detecting impurities, particularly when using E. coli expression systems, researchers should test for endotoxin contamination using the Limulus Amebocyte Lysate (LAL) assay, as endotoxins can interfere with downstream applications, especially immunological studies .

What experimental controls should be included when studying uspB function?

When designing experiments to study uspB function, the following controls are essential:

  • Negative Controls:

    • Buffer-only treatments to establish baseline measurements

    • Inactive protein variant (site-directed mutagenesis of critical residues)

    • Non-related protein of similar size and characteristics

  • Positive Controls:

    • Known stress response proteins with well-characterized functions

    • Commercial stress inducers when studying cellular responses

  • Technical Controls:

    • Multiple biological replicates (minimum n=3)

    • Multiple technical replicates within each biological replicate

    • Range of protein concentrations to establish dose-response relationships

  • Experimental Design Considerations:

    • Include appropriate time points to capture both immediate and delayed responses

    • Randomization of sample processing to avoid systematic errors

    • Blinding of researchers to treatment groups where applicable

Following the principles of Single-Subject Experimental Design (SSED), researchers should ensure replication within their study to rule out the plausibility of extraneous variables affecting their results .

What methodologies are most effective for characterizing uspB's role in Shigella virulence and pathogenesis?

To characterize the role of uspB in Shigella virulence and pathogenesis, researchers should employ a multi-faceted approach:

  • Gene Knockout Studies:

    • CRISPR-Cas9 or homologous recombination to generate uspB knockout strains

    • Complementation studies to confirm phenotype is due to uspB deletion

    • Growth curve analysis under various stress conditions

  • In Vitro Infection Models:

    • Intestinal epithelial cell invasion assays

    • Intracellular survival quantification

    • Cell-to-cell spread assessment using fluorescence microscopy

  • Transcriptomic and Proteomic Analysis:

    • RNA-Seq to identify genes differentially expressed in wildtype vs. uspB mutants

    • Proteomics to identify changes in protein expression profiles

    • ChIP-Seq if uspB may have regulatory functions

  • Animal Models:

    • Guinea pig or mouse models of shigellosis

    • Measurement of colonization, inflammation, and disease severity

    • Tissue-specific bacterial loads and histopathological assessment

When reporting results, researchers should follow the GRADE approach (Grading of Recommendations Assessment, Development and Evaluation) to assess the certainty of evidence, particularly when making claims about uspB's contribution to virulence .

How can researchers design experiments to study uspB structural characteristics and their relationship to function?

For comprehensive structural characterization of recombinant uspB and structure-function relationship studies:

  • High-Resolution Structural Analysis:

    • X-ray crystallography for atomic-level structure (resolution <2.0 Å ideal)

    • Nuclear Magnetic Resonance (NMR) for solution structure and dynamics

    • Cryo-Electron Microscopy for larger assemblies if uspB forms complexes

  • Computational Approaches:

    • Molecular dynamics simulations to study conformational changes

    • Structure-based virtual screening for potential inhibitor discovery

    • Homology modeling if experimental structures are challenging to obtain

  • Structure-Function Correlation:

    • Alanine scanning mutagenesis of conserved residues

    • Domain deletion/swapping experiments

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in binding events

  • Biophysical Interaction Studies:

    • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for binding studies in complex solutions

When designing these experiments, ensure appropriate controls are included for each technique, and consider using a combination of methods to build a comprehensive understanding of structure-function relationships.

What approaches can address challenges in expressing recombinant uspB with proper folding and solubility?

Addressing expression and folding challenges for recombinant uspB requires systematic optimization:

ChallengeSolution ApproachImplementation Details
InsolubilityFusion tagsMBP, SUMO, or Thioredoxin tags can enhance solubility
Codon optimizationOptimize codons for expression host to improve translation efficiency
Expression temperatureLower temperature (16-25°C) can improve folding
Improper foldingChaperone co-expressionCo-express with GroEL/GroES, DnaK/DnaJ/GrpE
Refolding protocolsGradual dialysis from denaturing conditions
AdditivesScreen stabilizing additives (glycerol, arginine, sucrose)
Low yieldMedia optimizationTest enriched media formulations
Induction conditionsOptimize inducer concentration and induction timing
Alternative hostsE. coli strains specialized for difficult proteins (Rosetta, Origami)

If comprehensive optimization of E. coli expression systems fails, consider alternative expression systems such as yeast, baculovirus, or mammalian cells as mentioned in the product information . Document all optimization steps systematically to establish a reproducible protocol for future studies.

How can researchers effectively design experiments to study uspB response to various stress conditions?

To rigorously study uspB response to different stress conditions, implement the following experimental design strategies:

  • Stress Condition Panel Design:

    • Temperature stress (heat shock, cold shock)

    • Oxidative stress (H₂O₂, paraquat)

    • Osmotic stress (high salt, sugar)

    • Nutrient limitation (carbon, nitrogen starvation)

    • pH stress (acidic, alkaline conditions)

    • Antimicrobial exposure (sub-inhibitory concentrations)

  • Time-Course Analysis:

    • Short-term responses (minutes to hours)

    • Long-term adaptation (hours to days)

    • Recovery phase monitoring

  • Quantitative Measurements:

    • uspB expression levels (RT-qPCR, Western blot)

    • Protein localization (immunofluorescence microscopy)

    • Post-translational modifications (mass spectrometry)

    • Interaction partners under different conditions (co-immunoprecipitation)

  • Systems Biology Approach:

    • Transcriptomic profiling under different stress conditions

    • Metabolomic analysis to identify metabolic shifts

    • Network analysis to place uspB in stress response pathways

When analyzing data, apply appropriate statistical methods and visual analysis techniques as described in Single-Subject Experimental Design literature, looking for changes in level, trend, or variability between conditions as evidence of experimental effects .

How can researchers investigate antimicrobial resistance in relation to uspB function in Shigella boydii?

To study the potential relationship between uspB function and antimicrobial resistance in Shigella boydii:

  • Comparative Analysis:

    • Compare uspB expression in antimicrobial-resistant vs. susceptible strains

    • Analyze uspB sequence variations across resistant isolates

    • Correlate uspB expression levels with minimum inhibitory concentrations (MICs)

  • Functional Studies:

    • Generate uspB knockout and overexpression strains

    • Determine whether altering uspB levels affects susceptibility to antibiotics

    • Test multiple antibiotic classes including those commonly used for shigellosis

  • Mechanisms Investigation:

    • Assess whether uspB affects efflux pump expression or activity

    • Investigate potential role in biofilm formation and antibiotic tolerance

    • Examine interactions with known resistance determinants

  • Clinical Correlation:

    • Collect and analyze clinical isolates for uspB expression and antimicrobial resistance

    • Document treatment outcomes in relation to uspB variants

    • Apply R-typing methods to characterize antimicrobial resistance patterns

For antimicrobial susceptibility testing, follow standardized methods using appropriate antibiotics as described in previous Shigella studies, including ampicillin, chloramphenicol, ciprofloxacin, streptomycin, sulfadiazine, tetracycline, and trimethoprim/sulfamethoxazole .

What techniques are recommended for studying uspB protein-protein interactions in the context of bacterial stress response?

For comprehensive characterization of uspB protein-protein interactions:

  • In Vitro Interaction Mapping:

    • Pull-down assays using tagged recombinant uspB

    • Surface Plasmon Resonance for real-time binding kinetics

    • Analytical ultracentrifugation to study complex formation

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • In Vivo Interaction Studies:

    • Bacterial two-hybrid systems

    • Proximity-based labeling (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET)

    • Co-immunoprecipitation followed by mass spectrometry

  • Systematic Screening Approaches:

    • Yeast two-hybrid screening against Shigella protein library

    • Protein microarray analysis

    • Affinity purification-mass spectrometry (AP-MS)

  • Validation and Functional Analysis:

    • Mutagenesis of predicted interaction sites

    • Competition assays with synthetic peptides

    • Phenotypic analysis of interaction-deficient mutants

    • Computational modeling of protein complexes

When reporting interaction studies, clearly document experimental conditions, especially stress conditions under which interactions were observed, as protein-protein interactions may be dynamic and stress-dependent.

How should researchers design experiments to evaluate uspB as a potential vaccine or therapeutic target?

To evaluate uspB as a potential vaccine or therapeutic target, researchers should implement a systematic approach:

  • Immunogenicity Assessment:

    • Epitope mapping to identify immunogenic regions

    • Animal immunization studies with purified recombinant uspB

    • Antibody titer measurement and specificity confirmation

    • T-cell response characterization (proliferation assays, cytokine profiling)

  • Protective Efficacy Studies:

    • Challenge studies in appropriate animal models

    • Measurement of bacterial load reduction

    • Clinical symptom severity assessment

    • Histopathological evaluation

  • Cross-Protection Analysis:

    • Evaluation against multiple Shigella serotypes

    • Assessment of strain coverage based on uspB conservation

    • Potential for broad-spectrum protection

  • Therapeutic Targeting:

    • High-throughput screening for small molecule inhibitors

    • Structure-based drug design targeting uspB functional sites

    • Peptidomimetic development based on interaction interfaces

    • Antibody-based therapeutic approaches

  • Safety Evaluation:

    • Cross-reactivity assessment with human proteins

    • Toxicity studies

    • Inflammatory response characterization

    • Long-term immunity and potential for adverse events

Remember that all recombinant protein products can only be used for research purposes and cannot be used directly on humans or animals . Any therapeutic development must progress through appropriate pre-clinical and clinical testing phases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.