Recombinant Shigella boydii serotype 18 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Overview of UPF0059 Membrane Protein YebN

YebN is annotated as a UPF0059 family membrane protein, a class of poorly characterized bacterial proteins with roles in membrane integrity and potential involvement in stress response or pathogenicity . In Shigella boydii serotype 18, YebN is encoded by the gene locus SSON_1339 (in S. sonnei homologs) and is predicted to contain transmembrane domains (TMDs), suggesting its integration into the bacterial membrane . Recombinant YebN is produced in heterologous systems like E. coli for functional and immunological studies.

Functional Insights from Homologs

  • Role in Membrane Integrity: YebN homologs in S. sonnei (e.g., SSON_0610/Rhom7) participate in quality control of orphan membrane proteins, cleaving nonfunctional TMDs to prevent cellular damage .

  • Pathogenicity Links: Membrane proteins in Shigella contribute to virulence by mediating interactions with host cells or resisting gut microbiota (e.g., colicins) .

  • Antigenic Potential: Recombinant Shigella membrane proteins are explored as vaccine targets due to their surface exposure and role in immune evasion .

Research Gaps and Future Directions

  • Functional Characterization: No direct studies on YebN’s enzymatic activity or regulatory role in S. boydii exist.

  • Diagnostic Utility: Serotype-specific genes (e.g., yebN) could serve as PCR targets for strain identification .

  • Vaccine Development: Recombinant YebN might elicit protective antibodies, but this requires validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; SbBS512_E2088; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii and how does it relate to other Shigella species?

Shigella boydii is a Gram-negative, rod-shaped, non-motile, non-spore-forming bacterium that belongs to the genus Shigella, which was first discovered in 1897. It represents one of the four recognized Shigella species alongside S. dysenteriae, S. flexneri, and S. sonnei3. While S. flexneri is the most prevalent species worldwide (accounting for approximately 60% of isolates), S. boydii is notable for being primarily restricted to the Indian subcontinent3 . Among the Shigella species, S. boydii exhibits the highest genetic diversity with 19 known serotypes, making it particularly interesting for comparative genomic studies3 .

From an evolutionary perspective, multilocus sequencing studies have placed Shigella within the Escherichia coli species, suggesting they are specialized pathovars of E. coli rather than a separate genus . This close genetic relationship is further evidenced by the observation that S. boydii shares a large proportion of chromosomal genes with non-pathogenic and enterohemorrhagic E. coli strains .

What is the UPF0059 membrane protein family and what is known about yebN?

The UPF0059 protein family represents uncharacterized protein family 0059, which includes membrane proteins found across various bacterial species. The yebN protein belongs to this family and is predicted to be a transmembrane protein with multiple membrane-spanning domains. Based on amino acid sequence analysis similar to that seen in S. sonnei's yebN, these proteins likely contain several transmembrane helices that anchor them within the bacterial cell membrane .

The amino acid sequence of UPF0059 membrane protein yebN in S. sonnei consists of 188 amino acids with a characteristic pattern of hydrophobic segments consistent with a membrane protein structure . Similar membrane proteins in Shigella may participate in critical cellular functions, potentially including solute transport, signal transduction, or maintenance of membrane integrity, though specific functions for yebN remain to be fully characterized.

How are recombinant Shigella proteins typically expressed and purified?

Recombinant Shigella proteins, including membrane proteins like yebN, can be expressed using several expression systems. The most common host systems include:

  • Escherichia coli expression systems: Most frequently used due to rapid growth, high protein yields, and genetic similarity to Shigella

  • Yeast expression systems: Useful for proteins requiring eukaryotic post-translational modifications

  • Baculovirus expression systems: Employed when complex folding or specific modifications are needed

  • Mammalian cell expression systems: Used when authentic mammalian processing is required

For membrane proteins like yebN, expression presents particular challenges due to their hydrophobic nature and potential toxicity to host cells. Purification typically involves:

  • Cell lysis using detergents to solubilize membrane proteins

  • Affinity chromatography utilizing fusion tags (commonly His-tags)

  • Size exclusion chromatography for further purification

  • Storage in stabilizing buffers, often with 50% glycerol to maintain protein integrity during freezing

The choice of tag type is frequently determined during the production process to optimize protein yield and functionality .

What role might yebN play in Shigella pathogenicity and virulence?

While the specific function of yebN in Shigella boydii serotype 18 has not been fully characterized, understanding of similar membrane proteins and Shigella pathogenicity mechanisms provides context for potential roles. Shigella virulence relies on several key factors:

  • Invasion of intestinal epithelial cells: Shigella species invade the epithelial lining of the intestines, causing inflammation and ulcerations that contribute to the symptoms of shigellosis3.

  • Toxin production: Various Shigella strains produce toxins that contribute to their virulence. While Shiga toxin is prominently associated with S. dysenteriae serotype 1, other toxins and virulence factors exist across Shigella species3 .

  • Pathogenicity islands: Shigella pathogenicity islands (SHI-1 and SHI-2) contribute significantly to virulence .

As a membrane protein, yebN could potentially be involved in:

  • Facilitating nutrient acquisition in the host environment

  • Contributing to antibiotic resistance through membrane permeability regulation

  • Participating in secretion systems essential for virulence factor delivery

  • Maintaining membrane integrity under host-induced stress conditions

Future research characterizing the yebN interactome and creating knockout mutants would be valuable in determining its specific contribution to S. boydii pathogenicity.

How does genomic diversity in Shigella boydii impact membrane protein expression and function?

Shigella boydii exhibits remarkable genomic diversity with 19 serotypes, more than any other Shigella species3 . This diversity likely affects membrane protein expression and function in several ways:

  • Pseudogene formation: Like other Shigella species, S. boydii genomes contain numerous pseudogenes, which may include altered versions of membrane protein genes .

  • Horizontal gene transfer: Laterally acquired genetic elements contribute to strain-specific differences in membrane protein repertoires.

  • Serotype-specific variations: The 19 different serotypes of S. boydii likely exhibit variations in membrane protein sequences and expression patterns, potentially affecting protein function and immunogenicity.

The Global Enteric Multicenter Study (GEMS) has analyzed 28 S. boydii isolates from Bangladesh and The Gambia, providing valuable comparative genomic data . These studies reveal that even within the same species, considerable genetic variation exists that could impact the structure, function, and expression of membrane proteins like yebN.

What antibiotic resistance mechanisms might involve membrane proteins in Shigella boydii?

Membrane proteins can play crucial roles in antibiotic resistance through various mechanisms. Based on resistance patterns observed in Shigella species, potential involvement of membrane proteins like yebN might include:

Antibiotic ClassResistance Rate in Related ShigellaPotential Membrane Protein Involvement
Ampicillin>80% in S. flexneri and S. sonneiEfflux pumps, reduced permeability
Third-generation cephalosporinsVariable; high in ESBL-producing strainsPorin modifications altering entry
Ciprofloxacin31.9-40.2%Altered membrane permeability
Trimethoprim-sulfamethoxazole97.6% in S. sonnei, 30% in S. flexneriEfflux mechanisms, permeability barriers

Recent surveillance data indicates concerning levels of extended-spectrum beta-lactamase (ESBL)-producing Shigella strains with reduced susceptibility to third-generation cephalosporins . Membrane proteins could contribute to this resistance by:

  • Altering cell envelope permeability to restrict antibiotic entry

  • Participating in efflux pump complexes that actively export antibiotics

  • Modifying the electrical potential across the membrane to affect uptake of charged antibiotics

  • Serving as sensors in two-component regulatory systems that control expression of resistance genes

Whole genome sequencing (WGS) has become increasingly important for antibiotic resistance surveillance in Shigella, allowing detection of resistance markers and typing of outbreak strains .

What expression strategies optimize yield and functionality of recombinant Shigella membrane proteins?

Optimizing expression of recombinant Shigella membrane proteins like yebN requires careful consideration of several factors:

  • Host selection: While E. coli is commonly used due to its genetic similarity to Shigella, specific strains engineered for membrane protein expression (such as C41(DE3) or C43(DE3)) may provide better results by tolerating potentially toxic membrane protein accumulation .

  • Vector design considerations:

    • Use of weak promoters to prevent overwhelming the membrane insertion machinery

    • Inclusion of fusion partners that enhance folding and membrane integration

    • Incorporation of solubility-enhancing tags like MBP (maltose-binding protein)

    • Addition of affinity tags positioned to avoid interference with protein folding

  • Expression conditions optimization:

    • Reduced temperature (16-25°C) to slow protein synthesis and improve folding

    • Addition of specific lipids that support membrane protein stability

    • Use of mild induction conditions with reduced inducer concentrations

    • Supplementation with specific chaperones that assist membrane protein folding

  • Scale-up strategies:

    • Fed-batch fermentation with controlled growth rates

    • Monitoring of dissolved oxygen to prevent stress responses

    • Fine-tuning of media composition to support membrane formation

When expressing UPF0059 membrane proteins like yebN, it's particularly important to balance protein production against potential toxicity and to ensure proper membrane integration for functional studies.

What analytical techniques are most effective for characterizing Shigella membrane protein structure and function?

Comprehensive characterization of recombinant Shigella boydii yebN requires multiple complementary approaches:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Nuclear magnetic resonance (NMR) for solution-state structural information

    • X-ray crystallography or cryo-electron microscopy for high-resolution structures

    • Molecular dynamics simulations to predict membrane interactions

  • Functional characterization:

    • Proteoliposome reconstitution to assess transport or channel activity

    • Electrophysiology measurements for channel-forming proteins

    • Binding assays to identify interaction partners

    • In vivo complementation studies using knockout mutants

  • Localization studies:

    • Immunofluorescence microscopy with specific antibodies

    • Fractionation techniques to confirm membrane association

    • GFP fusion approaches to track localization in living cells

  • Interaction studies:

    • Pull-down assays to identify protein-protein interactions

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Cross-linking approaches followed by mass spectrometry

Given the challenges in working with membrane proteins, it's often necessary to employ detergent screening to identify conditions that maintain native-like protein structure throughout purification and analysis.

How can genomic and transcriptomic approaches enhance understanding of yebN function in Shigella boydii?

Multi-omics approaches offer powerful insights into the function of poorly characterized proteins like yebN:

  • Comparative genomics:

    • Analysis of yebN conservation across the 19 serotypes of S. boydii

    • Identification of co-evolved gene clusters that may functionally interact with yebN

    • Phylogenetic analysis to trace evolutionary relationships with homologs in E. coli and other bacteria

  • Transcriptomics:

    • RNA-Seq under various growth and stress conditions to identify co-regulated genes

    • Assessment of yebN expression during infection models

    • Comparison of expression patterns between antibiotic-resistant and sensitive strains

  • Functional genomics:

    • CRISPR interference to modulate yebN expression and assess phenotypic effects

    • Transposon mutagenesis to identify genetic interactions

    • Creation of deletion and point mutants to assess protein domains essential for function

  • Systems biology integration:

    • Network analysis to place yebN in broader cellular pathways

    • Metabolomics to identify changes associated with yebN mutation

    • Modeling of membrane protein contributions to cellular homeostasis

The Global Enteric Multicenter Study (GEMS) collection of 28 S. boydii isolates provides an excellent resource for comparative genomic approaches, allowing researchers to correlate genetic variations in yebN with phenotypic differences across strains .

What controls and validation steps are essential for studies of recombinant Shigella membrane proteins?

Rigorous experimental design for studies involving recombinant Shigella boydii yebN should incorporate several key controls and validation steps:

  • Expression and purification validation:

    • Western blotting with tag-specific and protein-specific antibodies

    • Mass spectrometry confirmation of protein identity

    • Size-exclusion chromatography to assess homogeneity

    • Circular dichroism to confirm secondary structure integrity

  • Functional controls:

    • Empty vector controls for expression studies

    • Inactive mutant versions as negative controls

    • Known functional homologs as positive controls

    • Wild-type complementation to verify functional replacement

  • Experimental replication:

    • Biological replicates using independent protein preparations

    • Technical replicates to establish method reliability

    • Cross-validation using orthogonal techniques

  • Specificity controls:

    • Comparison with related membrane proteins from the same organism

    • Testing with proteins from the same family in different species

    • Competition assays to confirm binding specificity

When publishing studies on recombinant yebN, researchers should provide comprehensive methods sections detailing expression conditions, buffer compositions, and quality control measures to ensure reproducibility.

What are the challenges and solutions for studying membrane protein interactions in Shigella systems?

Investigating interaction partners of yebN presents several challenges that require specialized approaches:

  • Challenges in traditional methods:

    • Detergents required for membrane protein solubilization may disrupt weak interactions

    • Overexpression can lead to non-physiological interactions

    • Membrane environment complexity is difficult to replicate in vitro

  • Advanced solutions:

    • Proximity labeling approaches (BioID, APEX) to capture transient interactions in vivo

    • Native membrane vesicle isolation to maintain lipid environment

    • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) to preserve membrane context

    • Chemical cross-linking followed by mass spectrometry (XL-MS) to capture interactions before extraction

  • Genetic interaction mapping:

    • Synthetic genetic arrays to identify functional partners

    • CRISPR interference screens to detect genetic interactions

    • Suppressor mutation analysis to identify compensatory pathways

  • Computational predictions:

    • Co-evolution analysis to predict protein-protein interactions

    • Molecular docking simulations to model potential binding interfaces

    • Network analysis of transcriptomic data to identify functionally related genes

Understanding yebN interactions requires considering both direct protein-protein interactions and potential roles in larger multiprotein complexes within the bacterial membrane.

How might understanding yebN contribute to novel antimicrobial strategies against Shigella?

As antibiotic resistance continues to increase in Shigella species, with concerning levels of resistance to ampicillin (>80%), ciprofloxacin (31.9-40.2%), and the emergence of extended-spectrum beta-lactamase (ESBL) producers , novel antimicrobial targets are urgently needed. Membrane proteins like yebN could offer promising opportunities:

  • Target-based drug discovery:

    • If yebN proves essential for Shigella survival or virulence, it could be directly targeted

    • Structure-based design of small molecules that inhibit yebN function

    • Peptide inhibitors designed to disrupt specific protein-protein interactions

  • Membrane vulnerability exploitation:

    • Design of antimicrobial peptides that interact with membrane regions containing yebN

    • Development of permeability enhancers that work synergistically with existing antibiotics

    • Creation of targeted delivery systems that recognize surface-exposed domains of yebN

  • Immunological approaches:

    • If yebN has surface-exposed epitopes, it could be targeted by therapeutic antibodies

    • Vaccine development incorporating recombinant yebN fragments

    • T-cell based immunotherapies directed against yebN-derived peptides

  • Diagnostic applications:

    • Development of rapid tests based on yebN detection

    • Use of anti-yebN antibodies for serotype-specific identification

    • PCR-based methods targeting yebN gene variants for epidemiological tracking

The increasing application of whole genome sequencing for Shigella surveillance provides an opportunity to monitor yebN sequence variations across outbreaks and assess their potential relationship to virulence or treatment outcomes .

What in vivo models are most appropriate for studying the role of yebN in Shigella pathogenesis?

Investigating the role of yebN in S. boydii pathogenesis requires appropriate model systems that recapitulate key aspects of human infection:

  • Cell culture models:

    • Human intestinal epithelial cell lines (Caco-2, HT-29, T84)

    • Polarized cell monolayers to study invasion from the apical vs. basolateral side

    • 3D organoid cultures derived from intestinal stem cells

    • Co-culture systems incorporating immune cells to study inflammatory responses

  • Animal models:

    • Guinea pig keratoconjunctivitis model (Serény test) for invasiveness

    • Murine pulmonary infection model

    • Humanized mouse models with human intestinal xenografts

    • Primate models for species most susceptible to natural Shigella infection3

  • Ex vivo systems:

    • Human intestinal tissue explants

    • Perfused intestinal segments

    • Microfluidic gut-on-a-chip devices

  • Comparative approaches:

    • Testing wild-type S. boydii against yebN knockout mutants

    • Complementation with yebN variants from different serotypes

    • Competition assays between strains with different yebN alleles

When designing these studies, it's important to consider that Shigella primarily causes disease in primates (humans and gorillas) but not other mammals , which affects the translational relevance of various model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.