Recombinant Shigella boydii serotype 18 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; SbBS512_E3431; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the yqhA gene in Shigella boydii serotype 18?

The yqhA gene in S. boydii serotype 18 is part of the conserved gene clusters found within the Shigella genus. Genomic analysis of S. boydii reveals an average genome size of approximately 4.4 Mb (range 4.16-4.76 Mb) with a GC content of approximately 50.75% . The gene is likely located in one of the three major phylogenetic clades identified in S. boydii, with clade-specific gene distribution patterns that distinguish it from other Shigella species and E. coli . To determine the precise genomic context, researchers should perform whole genome sequencing followed by annotation using modern bioinformatics pipelines that can identify gene neighborhoods and potential operonic structures.

How does S. boydii serotype 18 differ phylogenetically from other serotypes?

S. boydii strains segregate into three distinct phylogenomic clades that are separate from E. coli reference genomes, with clade 1 potentially further subdivided into two additional subgroups . These divisions are not strictly correlated with geographic location or isolation date, suggesting that the phylogenetic structure represents deeper evolutionary patterns within the species . Serotype 18, like other S. boydii serotypes, would be distributed within this phylogenetic framework based on core genome single nucleotide polymorphism (SNP) analysis. Comparative genomic approaches using Mugsy algorithm for alignment have demonstrated approximately 3.0 Mb of conserved genomic content across S. boydii isolates, indicating substantial conservation within the species despite serotypic differences .

What is the predicted structure and function of UPF0114 protein YqhA in S. boydii?

The UPF0114 family proteins, including YqhA, are conserved across many bacterial species, though their precise function remains uncharacterized (hence "UPF" - Uncharacterized Protein Family). Based on sequence conservation patterns and structural predictions, YqhA likely functions in cellular processes common to Enterobacteriaceae. While the specific function remains to be experimentally determined, structural analysis through X-ray crystallography or cryo-EM would provide insights into potential functional domains. Researchers should consider comparative analyses with homologous proteins in related species and employ techniques such as bacterial two-hybrid screening to identify potential interaction partners that might suggest functional roles.

What are the optimal expression systems for producing recombinant S. boydii YqhA protein?

For optimal expression of recombinant S. boydii YqhA protein, both E. coli and yeast expression systems have been utilized successfully, as evidenced by commercial availability of the protein from these systems . For bacterial expression, BL21(DE3) or Rosetta strains are recommended to address potential codon bias issues. The protein can be expressed with various tags (His, GST, MBP) to facilitate purification, with the optimal tag determined by protein solubility testing.

Comparison of Expression Systems for S. boydii YqhA Protein:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, rapid growth, cost-effectivePotential lack of post-translational modificationsIPTG induction (0.1-1.0 mM), 16-30°C, 4-16 hours
Yeast (S. cerevisiae)Post-translational modifications, proper foldingLower yield, longer production timeGalactose induction, 28-30°C, 24-72 hours
MammalianNative-like post-translational modificationsHighest cost, complex protocolsTransfection optimization required

The choice of expression system should be guided by downstream applications and required protein characteristics.

What purification strategy yields highest purity and biological activity of recombinant YqhA?

A multi-step purification strategy yields the highest purity and biological activity for recombinant YqhA. Based on established protocols for similar bacterial proteins, the following methodology is recommended:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged constructs)

  • Intermediate purification via ion-exchange chromatography (typically anion exchange at pH 8.0)

  • Polishing step using size-exclusion chromatography to remove aggregates

Buffer optimization is critical for maintaining protein stability, with typical buffers containing 20-50 mM Tris-HCl (pH 7.5-8.0), 100-300 mM NaCl, and potentially 5-10% glycerol as a stabilizing agent. Protein activity should be assessed after each purification step using functional assays specific to the hypothesized function of YqhA. For long-term storage, flash-freezing aliquots in liquid nitrogen after addition of 10% glycerol is recommended to maintain activity.

How can researchers validate the correct folding and structural integrity of purified YqhA?

Validation of correct folding and structural integrity requires multiple complementary techniques:

  • Circular Dichroism (CD) spectroscopy to assess secondary structure content

  • Differential Scanning Fluorimetry (DSF) to determine thermal stability and buffer optimization

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS) to confirm monomeric state and absence of aggregation

  • Limited proteolysis to probe for properly folded domains resistant to digestion

  • NMR 1H-15N HSQC spectra for tertiary structure assessment if isotopically labeled protein is available

These methods should be employed sequentially, starting with CD spectroscopy to quickly assess general folding characteristics before proceeding to more resource-intensive techniques. Comparing the spectroscopic and biophysical profiles with well-characterized homologs can provide benchmarks for expected results.

What experimental approaches can determine the biological function of YqhA in S. boydii?

Determining the biological function of YqhA requires a multi-faceted approach:

  • Genomic context analysis: Examine neighboring genes for functional clues, as prokaryotic genomes often organize related functions in operons

  • Gene knockout/knockdown studies: Generate deletion mutants in S. boydii and assess phenotypic changes under various growth conditions

  • Protein-protein interaction studies: Use pull-down assays, bacterial two-hybrid systems, or crosslinking mass spectrometry to identify interaction partners

  • Transcriptomic profiling: Compare gene expression patterns between wild-type and YqhA-deficient strains

  • Metabolomic analysis: Identify metabolic pathways altered in YqhA mutants

  • Structural biology: Solve the 3D structure for function prediction based on structural homology

  • Complementation studies: Test if YqhA homologs from related species can rescue knockout phenotypes

Since S. boydii is phylogenetically distinct yet shares genomic features with E. coli and other Shigella species, comparative functional analyses across these related organisms may provide valuable insights into conserved functions .

How does YqhA protein expression correlate with S. boydii virulence and pathogenicity?

The relationship between YqhA expression and S. boydii virulence requires investigation through several approaches:

  • Expression analysis during infection: Quantify yqhA transcription and translation during different stages of cellular infection using RT-qPCR and Western blotting

  • Tissue culture infection models: Compare invasion and replication efficiency between wild-type and yqhA mutant strains in epithelial cell lines

  • Inflammatory response assessment: Measure cytokine production in infected host cells

  • Animal model studies: Evaluate infection progression and pathology in appropriate animal models

S. boydii pathogenicity is largely dependent on its O antigen structure and virulence genes. While not directly implicated in virulence based on current knowledge, proteins of unknown function like YqhA may play roles in stress response, metabolism, or other processes that indirectly affect pathogenic potential . Researchers should consider that S. boydii has a unique evolutionary history separate from other Shigella and E. coli strains, which may influence protein function in pathogenicity .

What are the challenges in producing consistent batches of functionally active recombinant YqhA for research?

Producing consistent batches of functionally active recombinant YqhA presents several challenges:

  • Expression variability: Different batches may express at variable levels due to subtle differences in growth conditions

  • Protein solubility issues: Membrane-associated or hydrophobic regions may cause aggregation

  • Post-translational modifications: Bacterial expression systems may not reproduce native modifications

  • Endotoxin contamination: LPS from expression hosts can interfere with downstream applications

  • Functional validation: Without clearly established functional assays, batch consistency is difficult to verify

To address these challenges, researchers should:

  • Develop detailed SOPs for expression and purification

  • Implement multiple quality control checkpoints (SDS-PAGE, Western blot, activity assays)

  • Utilize reference standards from previous successful batches

  • Consider expression tag influence on protein function and remove tags when necessary

  • Develop functional assays based on predicted protein activities

Establishing reproducible methods for protein production is essential for meaningful research on proteins of unknown function like YqhA .

How can structural comparisons between YqhA proteins from different S. boydii serotypes inform evolutionary relationships?

Structural comparison of YqhA proteins across S. boydii serotypes provides valuable evolutionary insights beyond sequence-based phylogeny. Researchers should:

  • Obtain high-resolution structures using X-ray crystallography or cryo-EM for YqhA proteins from multiple serotypes

  • Perform structural alignments to identify conserved domains and variable regions

  • Map sequence variations onto structural models to assess functional implications

  • Analyze selection pressures on different protein regions using dN/dS ratios

  • Correlate structural differences with serotype-specific characteristics

The phylogenomic analysis of S. boydii has identified three distinct clades with clade-specific gene content . Structural studies of YqhA could potentially align with these genomic divisions, offering insights into how protein structure evolution correlates with genome evolution. Additionally, structural comparisons might reveal adaptive changes in response to different host environments or immune pressures.

What role might YqhA play in the adaptation of S. boydii to different environmental niches?

The potential role of YqhA in environmental adaptation can be investigated through:

  • Expression profiling under various environmental stressors (pH, temperature, osmotic pressure, nutrient limitation)

  • Comparative growth studies of wild-type and yqhA mutants under diverse conditions

  • Transcriptomic analysis to identify co-regulated genes under stress conditions

  • Protein localization studies under different environmental conditions

S. boydii shows distinct genetic characteristics that separate it from E. coli and other Shigella species . YqhA may contribute to these unique adaptations, potentially playing roles in:

  • Stress response mechanisms specific to human host environments

  • Metabolic adaptation to nutrient-limited conditions

  • Resistance to host defense mechanisms

  • Biofilm formation or other community behaviors

Given that S. boydii contains clade-specific genes related to transmembrane proteins and metabolism , YqhA might function within these specialized systems that contribute to S. boydii's ecological niche adaptation.

How can computational approaches predict potential binding partners or substrates for YqhA?

Computational prediction of YqhA binding partners or substrates should employ multiple complementary approaches:

  • Homology-based function prediction: Identify structural similarities with proteins of known function

  • Protein-protein interaction network analysis: Use interolog mapping from related species

  • Machine learning approaches: Apply deep learning models trained on known bacterial protein interactions

  • Molecular docking simulations: Screen potential small molecule substrates based on binding site analysis

  • Genomic context analysis: Identify functionally related genes through conserved genomic neighborhoods

Computational Analysis Pipeline for YqhA Functional Prediction:

Analytical ApproachTools/ResourcesExpected OutcomesValidation Methods
Sequence analysisBLAST, HHpred, PFAMIdentification of conserved domains and motifsTargeted mutagenesis of predicted functional residues
Structural modelingAlphaFold2, RoseTTAFold3D structure prediction with binding pocket analysisExperimental structure determination
Genomic neighborhoodSTRING, MicrobesOnlineIdentification of functionally related genesCo-expression analysis, genetic interaction studies
Binding site predictionCASTp, FTMapPrediction of potential ligand binding regionsSite-directed mutagenesis, binding assays
Co-evolution analysisGREMLIN, EVcouplingsPrediction of residue contacts and protein partnersCrosslinking and pull-down experiments

These computational predictions should guide subsequent experimental validation using techniques such as affinity purification-mass spectrometry, bacterial two-hybrid screening, and in vitro binding assays.

How might CRISPR-based technologies enhance functional studies of YqhA in S. boydii?

CRISPR-based technologies offer powerful approaches for studying YqhA function in S. boydii:

  • Precise genome editing: Generate clean deletions, point mutations, or tagged versions of yqhA without antibiotic markers

  • CRISPRi applications: Create inducible knockdown systems to study essential genes or modulate expression levels

  • CRISPRa approaches: Upregulate yqhA expression to assess overexpression phenotypes

  • Base editing: Introduce specific amino acid changes without double-strand breaks

  • CRISPR screening: Perform genome-wide screens to identify genetic interactions with yqhA

The application of CRISPR technologies to S. boydii should consider the specific genetic background of this organism, including its phylogenetic separation into three distinct clades . Optimization of CRISPR systems may be required for efficient editing in S. boydii, which has unique genomic features compared to model organisms like E. coli.

What are the implications of S. boydii genomic diversity for YqhA functional conservation across strains?

The genomic diversity of S. boydii has significant implications for YqhA functional conservation:

  • Sequence conservation analysis across the three major phylogenetic clades of S. boydii can reveal selection pressures on yqhA

  • Examination of clade-specific genetic contexts may suggest different functional associations

  • Assessment of gene presence/absence patterns across the core (2230 genes) and pan-genome of S. boydii

  • Evaluation of YqhA conservation relative to the 7355 gene clusters identified in S. boydii genomes

Given that S. boydii shows substantial genomic diversity with clade-specific genes (15 genes in clade 1, 56 genes in clade 2, and 38 genes in clade 3) , YqhA function may have evolved differently across these lineages. Researchers should consider this diversity when designing experiments and interpreting results across different S. boydii strains.

How can multi-omics approaches provide comprehensive insights into YqhA function in cellular pathways?

Multi-omics integration offers a holistic view of YqhA function through:

  • Integrative analysis pipeline:

    • Transcriptomics: Compare global expression patterns between wild-type and yqhA mutant strains

    • Proteomics: Identify changes in protein abundance and post-translational modifications

    • Metabolomics: Detect altered metabolic pathways and small molecule profiles

    • Interactomics: Map physical and genetic interaction networks

    • Phenomics: Systematically characterize phenotypic consequences of yqhA mutation

  • Data integration strategies:

    • Pathway enrichment analysis across multiple datasets

    • Network-based integration to identify functional modules

    • Machine learning approaches to predict functional relationships

    • Temporal analysis to capture dynamic responses

This integrated approach can reveal how YqhA participates in cellular processes beyond what any single technique could identify. For example, if YqhA functions in a metabolic pathway, transcriptomic changes might reveal altered gene expression, while metabolomic data could identify specific accumulated or depleted metabolites, providing complementary evidence for its role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.