Recombinant Shigella boydii serotype 18 UPF0208 membrane protein YfbV (yfbV)

What is the structural classification of Shigella boydii YfbV protein?

YfbV from Shigella boydii serotype 18 is classified as a transmembrane protein belonging to the UPF0208 family of uncharacterized proteins. It contains the DUF412 domain (Domain of Unknown Function 412), which is conserved across multiple bacterial species. The protein consists of 151 amino acids with a molecular structure that features transmembrane regions characteristic of integral membrane proteins . The amino acid sequence (MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPFVENRVIKMTRYAIRFMPP IAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL) suggests multiple hydrophobic segments consistent with its membrane-spanning topology .

How conserved is the YfbV protein sequence across bacterial species?

YfbV represents a highly conserved membrane protein found across multiple Enterobacteriaceae family members. Sequence comparison analysis reveals significant homology between YfbV proteins from Shigella boydii and those from other bacterial species including Escherichia coli, Salmonella species, and Klebsiella pneumoniae . The conservation pattern suggests functional importance, despite its currently uncharacterized status. Particularly noteworthy is that the DUF412 domain-containing region shows the highest degree of conservation, implying evolutionary pressure to maintain this structural feature across diverse bacterial lineages .

What are the theoretical physicochemical properties of S. boydii YfbV protein?

Based on the amino acid sequence, Shigella boydii serotype 18 YfbV protein exhibits the following theoretical physicochemical properties:

The protein contains multiple hydrophobic regions consistent with its transmembrane nature, which significantly impacts its solubility characteristics and experimental handling requirements .

What expression systems are most effective for producing recombinant S. boydii YfbV?

The most effective expression system for producing recombinant Shigella boydii YfbV protein is the in vitro E. coli expression system, which balances yield with proper folding of the membrane protein . When expressing this transmembrane protein, researchers should consider the following methodological approaches:

• Use of specifically designed E. coli strains (such as C41(DE3) or C43(DE3)) that are optimized for membrane protein expression

• Induction with lower IPTG concentrations (0.1-0.5 mM) at reduced temperatures (16-25°C)

• Addition of membrane-stabilizing compounds like glycerol (5-10%) to the culture medium

• Consideration of cell-free expression systems for difficult constructs

Commercial preparations typically utilize E. coli expression systems with N-terminal histidine tags to facilitate purification while maintaining protein functionality .

What are the optimal storage conditions for maintaining YfbV stability?

For optimal stability of recombinant Shigella boydii YfbV protein, storage at -20°C is recommended for routine use, while extended storage should be at -20°C or preferably -80°C . The protein stability is significantly enhanced by following these methodological guidelines:

• Aliquoting the purified protein into single-use volumes to avoid repeated freeze-thaw cycles

• Including appropriate stabilizers such as glycerol (10-25%) in storage buffers

• Maintaining pH in the 7.0-8.0 range with buffers like Tris-HCl or phosphate

• Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided

• For lyophilized forms, shelf life extends to approximately 12 months at -20°C/-80°C, compared to 6 months for liquid forms

How can researchers effectively solubilize and purify YfbV for structural studies?

Effective solubilization and purification of YfbV require specialized approaches due to its transmembrane nature:

• Initial membrane fraction isolation through differential centrifugation (30,000-100,000 × g)

• Solubilization using mild detergents such as:

  • n-Dodecyl β-D-maltoside (DDM) at 1-2%

  • n-Octyl-β-D-glucopyranoside (OG) at 0.5-1%

  • Digitonin at 0.5-1%

• Affinity purification utilizing the N-terminal 10xHis-tag with Ni-NTA resin

• Size-exclusion chromatography to enhance purity beyond 85%

• Optional detergent exchange during purification to more suitable detergents for downstream applications

• For structural studies, incorporation into nanodiscs or amphipols may improve stability

Researchers should monitor protein quality at each step using SDS-PAGE to ensure purity levels of at least 85%, which is the standard for commercially available preparations .

What is the potential relationship between YfbV and bacterial pathogenesis?

While the direct function of YfbV remains uncharacterized, comparative analysis with other membrane proteins suggests potential involvement in pathogenesis pathways. Research indicates that membrane proteins in Shigella species frequently contribute to virulence through mechanisms such as:

• Cell envelope integrity maintenance

• Stress response signaling

• Nutrient acquisition in host environments

• Potential involvement in biofilm formation

Although YfbV has not been directly implicated in virulence, its conservation across pathogenic enterobacteria suggests functional importance . The related YfiBNR signaling system in Shigella, which involves the outer membrane protein YfiB, regulates cyclic-di-GMP levels that affect biofilm formation, cytotoxicity, and bacterial invasion capabilities . This suggests membrane proteins like YfbV may participate in similar regulatory networks affecting pathogen survival and virulence.

How might YfbV interact with the bacterial cyclic-di-GMP signaling pathway?

While direct evidence for YfbV interaction with cyclic-di-GMP signaling is limited, related membrane proteins in Shigella demonstrate important regulatory roles in this pathway. Research on the YfiBNR system provides a model for how membrane proteins can influence cyclic-di-GMP levels:

• Membrane proteins like YfiB can sequester regulatory proteins (such as YfiR) to the outer membrane

• This sequestration affects the inhibition of diguanylate cyclase (DGC) activity of proteins like YfiN

• Changes in DGC activity directly modulate intracellular cyclic-di-GMP concentrations

• Cyclic-di-GMP levels subsequently regulate biofilm formation, motility, and virulence factor expression

Given that YfbV is also a membrane protein in Shigella, researchers should investigate potential interactions with known components of cyclic-di-GMP signaling pathways through approaches such as bacterial two-hybrid assays, co-immunoprecipitation, or cross-linking studies.

How does YfbV compare functionally to membrane proteins in other pathogens?

Functional comparison of YfbV with membrane proteins from other pathogens reveals several important patterns:

• The DUF412 domain found in YfbV is shared with membrane proteins across multiple pathogenic bacteria, suggesting conserved but as-yet-uncharacterized functions

• Similar membrane proteins in Pseudomonas aeruginosa and other pathogens participate in stress response and virulence regulation

• The closest characterized homologs suggest potential roles in:

  • Membrane integrity maintenance

  • Signal transduction

  • Transport functions

  • Stress response

Experimental approaches to elucidate these functions include comparative phenotypic analysis of knockout mutants across species, heterologous complementation studies, and interactome mapping through proteomic approaches .

What mutagenesis strategies are most effective for studying YfbV function?

For comprehensive functional characterization of YfbV, researchers should implement a multi-layered mutagenesis strategy:

• Complete gene knockout through double homologous recombination (similar to the approach used for yfiB gene knockout studies)

• Domain-specific mutations targeting:

  • The DUF412 domain to assess its functional importance

  • Predicted transmembrane regions to assess membrane localization requirements

  • Conserved amino acid residues identified through multiple sequence alignment

• Site-directed mutagenesis of specific amino acids, prioritizing:

  • Highly conserved residues across bacterial species

  • Charged residues in transmembrane regions

  • Potential phosphorylation or glycosylation sites

• Construction of chimeric proteins with domains from related proteins to identify functional regions

Each mutant should be assessed through complementation assays and phenotypic characterization, particularly examining effects on membrane integrity, stress response, and potentially virulence in appropriate models .

What cellular localization approaches best confirm YfbV membrane integration?

To definitively confirm the membrane localization and topology of YfbV, researchers should employ multiple complementary approaches:

• Subcellular fractionation with western blotting:

  • Sequential isolation of cytoplasmic, periplasmic, inner membrane, and outer membrane fractions

  • Detection of YfbV using specific antibodies or tag-based detection

• Fluorescence microscopy techniques:

  • GFP-fusion constructs with careful design to minimize functional interference

  • Super-resolution microscopy for precise localization within membrane microdomains

• Protease accessibility assays:

  • Controlled proteolytic digestion of spheroplasts or intact cells

  • Mass spectrometry analysis of protected fragments

• Membrane topology mapping:

  • PhoA/LacZ fusion analysis at different positions

  • Cysteine scanning mutagenesis followed by accessibility testing with membrane-impermeable reagents

These approaches collectively provide robust confirmation of membrane integration and orientation of YfbV .

How can researchers effectively study potential YfbV protein-protein interactions?

To identify and characterize YfbV protein interaction partners, researchers should implement a multi-method approach:

• In vivo cross-linking followed by mass spectrometry:

  • Chemical cross-linkers of varying spacer lengths

  • Formaldehyde cross-linking for capturing transient interactions

  • MS/MS analysis for identification of interaction partners

• Bacterial two-hybrid screening:

  • Construction of genomic libraries for systematic screening

  • Verification with reverse two-hybrid approaches

• Co-immunoprecipitation with tagged YfbV:

  • Use of mild detergents to maintain membrane protein interactions

  • Native elution conditions to preserve complexes

• Proximity labeling approaches:

  • BioID or APEX2 fusions to YfbV

  • Identification of proteins in close proximity within the native environment

• Surface plasmon resonance or microscale thermophoresis:

  • For quantitative analysis of identified interactions

  • Determination of binding kinetics and affinity constants

These approaches are particularly valuable for identifying potential connections between YfbV and components of signaling systems like the YfiBNR pathway .

What are the common challenges in purifying functional YfbV and how can they be overcome?

Researchers frequently encounter several challenges when purifying membrane proteins like YfbV:

• Low expression yields:

  • Solution: Optimize codon usage for expression host

  • Solution: Test multiple promoter systems (T7, tac, arabinose-inducible)

  • Solution: Evaluate expression in specialized strains like C41(DE3)

• Protein aggregation:

  • Solution: Screen multiple detergents systematically (DDM, LDAO, LMNG)

  • Solution: Include stabilizing additives (glycerol, specific lipids)

  • Solution: Reduce expression temperature to 16-20°C

• Poor affinity tag accessibility:

  • Solution: Test both N- and C-terminal tag positions

  • Solution: Include longer linker sequences between tag and protein

  • Solution: Consider dual tagging approaches

• Detergent-induced functional loss:

  • Solution: Reconstitute into nanodiscs or liposomes after purification

  • Solution: Use gentler extraction approaches like styrene maleic acid lipid particles (SMALPs)

• Contaminant co-purification:

  • Solution: Implement multi-step purification (IMAC followed by ion exchange and SEC)

  • Solution: Include additional washing steps with low concentrations of competitors

Maintaining protein stability throughout the purification process is critical, with 85% purity achievable through optimized protocols .

How can researchers differentiate between YfbV and related membrane proteins in functional studies?

Differentiating YfbV from related membrane proteins requires several methodological approaches:

• Specific antibody generation and validation:

  • Target unique epitopes identified through sequence alignment

  • Validate specificity against knockout strains and purified proteins

• Genetic approaches:

  • Creation of clean deletion mutants without polar effects

  • Complementation with epitope-tagged variants under native promoters

  • CRISPR-Cas9 specific tagging of endogenous proteins

• Mass spectrometry characterization:

  • Proteotypic peptide identification unique to YfbV

  • Quantitative proteomic approaches to monitor expression

  • Modified protein domains through specialized MS approaches

• Functional complementation testing:

  • Cross-species complementation assays

  • Domain-swapping experiments between YfbV and related proteins

These approaches collectively enable researchers to distinguish YfbV-specific functions from those of related proteins, particularly important when studying bacterial species with multiple homologous membrane proteins .

What are the recommended approaches for studying YfbV in the context of bacterial infection models?

When investigating YfbV in infection models, researchers should consider these methodological approaches:

• Construction of isogenic mutants:

  • Clean deletion without antibiotic markers when possible

  • Complementation with wild-type and mutant variants

  • Inducible expression systems for controlled studies

• Cell culture infection models:

  • Epithelial cell invasion assays (gentamicin protection)

  • Macrophage survival assays

  • Polarized epithelial models for directional infection

• In vivo models with appropriate controls:

  • Mouse intestinal infection models

  • Streptomycin pre-treatment for Shigella models

  • Monitoring bacterial loads in target tissues

  • Assessment of inflammatory markers

• Comparative virulence assessment:

  • Competition assays between wild-type and yfbV mutants

  • Transcriptional profiling during infection

  • Imaging of bacterial protein localization during host cell interaction

These approaches should be combined with molecular and cellular analyses to correlate YfbV function with specific steps in the infection process, similar to approaches used with other membrane proteins in Shigella .