Recombinant Shigella boydii serotype 18 UPF0756 membrane protein YeaL (yeaL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Shigella boydii Serotype 18 UPF0756 Membrane Protein YeaL (yeaL)

Recombinant Shigella boydii serotype 18 UPF0756 membrane protein YeaL (yeaL) is a genetically engineered antigen derived from the Gram-negative bacterium Shigella boydii, a leading cause of bacillary dysentery. This protein, encoded by the yeaL gene (locus SbBS512_E2042), is part of the UPF0756 family and is expressed in heterologous systems like Escherichia coli for vaccine research and diagnostic applications . Its recombinant form retains structural and immunological properties critical for studying Shigella pathogenesis and developing targeted interventions.

Primary Structure

  • Amino Acid Sequence: Residues 1–148 (MFDVTLLILLGLAALGFISHNTTVAVSILVLIIRVTPLSTFFPWIEQQGLSIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ) .

  • Molecular Weight: ~17 kDa (calculated) .

  • UniProt ID: B2U422 .

Genomic Context

  • The yeaL gene is located in S. boydii serotype 18 (strain CDC 3083-94/BS512) and shares genomic clade-specific features. Comparative studies reveal that S. boydii clade 1 contains 98 unique genes, including inner membrane transport components and zinc-binding proteins, which may include yeaL .

Recombinant Expression

  • Expression System: Optimized in E. coli with yields >90% purity .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C .

Research Applications

  1. Vaccine Development: Used as an antigen in preclinical studies to elicit immune responses against Shigella .

  2. Diagnostic Tools: Serves as a target for ELISA-based detection of S. boydii infections .

Challenges and Future Directions

  • Functional Characterization: Further studies are needed to elucidate YeaL’s role in bacterial physiology and host-pathogen interactions.

  • Clinical Validation: Preclinical efficacy data are lacking; adjuvants or fusion platforms (e.g., MEFA) could enhance immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference for your own protocols.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag based on your request.
Synonyms
yeaL; SbBS512_E2042; UPF0756 membrane protein YeaL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
yeaL
Target Protein Sequence
MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEQQGLSIGIIILTI GVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGT VLGVALFRGVPVGPLIAAGLVSLIVGKQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic and clinical significance of Shigella boydii?

Shigella boydii is one of four recognized Shigella subgroups, which are human-adapted lineages of Escherichia coli that evolved to cause severe diarrheal disease called shigellosis. S. boydii has 20 distinct serotypes, with type 1 representing the second most prevalent serotype in Bangladesh according to recent epidemiological studies. The World Health Organization has designated Shigella as a priority area for research and development of new therapeutic interventions due to its significant global health impact, particularly in low and middle-income countries .

How does Shigella boydii differ genomically from other Shigella species?

Shigella species emerged from E. coli following the acquisition of a large virulence plasmid (pINV, 210-240 Kbp) that confers the ability to invade human cells. Throughout their pathoadaptation, Shigella genomes have undergone significant gene loss, primarily associated with insertion sequences (ISs). These small transposable elements can mobilize within the genome, disrupt coding sequences, and mediate genome rearrangements. Each Shigella subgroup harbors significantly more copies of ISs than other E. coli pathotypes, contributing to their genomic plasticity and adaptive evolution .

What is known about membrane proteins like YeaL in Gram-negative bacteria?

Membrane proteins, particularly outer membrane proteins (OMPs), are essential components of the Gram-negative bacterial cell envelope. They play crucial roles in nutrient transport, signaling, and maintaining membrane integrity. The assembly of these proteins involves sophisticated machinery, including the β-barrel assembly machinery (BAM) complex. Recent research has revealed that OMPs contain both terminal β-signals and internal β-signals that are recognized by the BAM complex for proper membrane insertion and assembly. While the internal signal-BamD ordering system is not essential for bacterial viability, it is necessary for maintaining outer membrane integrity against antibiotics and environmental stressors .

What are the optimal growth conditions for recombinant membrane protein expression?

Successful production of membrane proteins requires careful optimization of growth conditions. Contrary to conventional assumptions, research indicates that the most rapid growth conditions are not necessarily optimal for membrane protein production. Instead, growth under tightly-controlled conditions with harvesting prior to glucose exhaustion (just before the diauxic shift) significantly improves yield. This critical timing appears to be related to the differential expression of genes involved in membrane protein secretion and cellular physiology rather than changes in target gene mRNA levels .

How should bioreactor parameters be optimized for membrane protein expression?

To maximize membrane protein production, high-performance bioreactors should be employed with systematic quantification of cultures under tightly-defined growth regimes. Key parameters to monitor include:

ParameterOptimal RangeImpact on Protein Expression
Growth rateModerate (not maximal)Allows proper protein folding
Glucose concentrationMaintain above depletionPrevents triggering of stress responses
Dissolved oxygen30-50% saturationSupports proper protein folding
TemperatureTypically 25-30°CReduces inclusion body formation
pH6.5-7.5Maintains optimal cellular physiology

Harvesting cells at precisely the right physiological state (prior to glucose exhaustion) is critical for maximizing functional membrane protein yield .

How can genomic sequencing data inform structural predictions for membrane proteins like YeaL?

Complete genome sequencing, particularly using technologies that produce long reads capable of spanning repetitive regions, can provide valuable insights into membrane protein structure and function. For Shigella proteins, whole genome sequencing has revealed phylogenomic diversity and evidence of ongoing adaptive evolution, including structural variations mediated by insertion sequences. These genomic insights can be used to predict transmembrane domains, identify conserved motifs, and understand the evolutionary context of membrane proteins like YeaL. Additionally, comparative genomics across different Shigella lineages can highlight conserved regions that may be functionally significant .

What is the significance of β-signal sequences in membrane protein assembly?

Recent research has challenged the traditional understanding of outer membrane protein assembly by demonstrating that beyond the C-terminal β-signal, internal β-signals also play crucial roles in protein assembly. BamD, an essential subunit of the BAM complex, recognizes both terminal and internal signals, arranging several β-strands and facilitating partial folding for efficient OMP assembly. When designing expression constructs for recombinant membrane proteins, preserving these signal sequences is essential for proper folding and membrane integration. Mutational analysis has shown that alterations to these signals can significantly impair assembly efficiency and membrane integrity .

How can phage-based methods be adapted for studying membrane proteins?

Phage-based approaches offer innovative methods for membrane protein research. Similar to the phage MK-13 used for specific detection of S. boydii type 1, phages that recognize specific membrane proteins could be isolated and utilized as molecular tools. These phages could be employed for:

ApplicationMethodologyAdvantage
Protein detectionPhage-based ELISAHigh specificity and sensitivity
Functional studiesPhage displayIdentification of interaction partners
Structural analysisCryo-EM of phage-protein complexesVisualization of native conformations
Expression screeningPhage infection assaysRapid assessment of surface expression

The specificity of phage-host interactions makes this approach particularly valuable for distinguishing between closely related membrane proteins .

What are the major bottlenecks in recombinant membrane protein purification?

Membrane protein purification represents one of the primary bottlenecks in structural genomics programs. The challenges include:

  • Low expression levels compared to soluble proteins

  • Maintaining native conformation during extraction from the membrane

  • Selecting appropriate detergents that solubilize without denaturing

  • Preserving stability during concentration and crystallization

  • Establishing purification protocols that yield homogeneous protein samples

These challenges often necessitate trial-and-error approaches, which frequently yield insufficient amounts for structural studies. Systematic optimization of each purification step is therefore critical for success .

How can protein folding and stability be assessed during membrane protein production?

Monitoring protein folding and stability during production is essential for obtaining functional membrane proteins. Methods include:

Assessment MethodMeasured ParameterApplication
Circular dichroismSecondary structure contentRapid screening of folding conditions
Fluorescence spectroscopyTertiary structure integrityDetecting conformational changes
Size exclusion chromatographyAggregation stateAssessing homogeneity
Thermal shift assaysProtein stabilityOptimizing buffer conditions
Functional assaysBiological activityConfirming native conformation

Each technique provides complementary information about protein quality, helping researchers optimize conditions for maintaining the native state of membrane proteins like YeaL during expression and purification .

What strategies can overcome insertion sequence-mediated instability in Shigella genome analysis?

Shigella genomes contain numerous insertion sequences that can create challenges for genome assembly and stability of expression constructs. Research has shown that Shigella genomes harbor significantly more copies of ISs than other E. coli pathotypes, contributing to exceptional rates of structural variation. When working with genomic material from Shigella, researchers should consider:

  • Using long-read sequencing technologies to span repetitive regions

  • Employing specialized assembly algorithms designed for highly repetitive genomes

  • Verifying construct stability through multiple passages

  • Considering synthetic biology approaches to recreate coding sequences without destabilizing elements

  • Monitoring potential IS-mediated rearrangements during expression

How can contradictory data on membrane protein assembly mechanisms be reconciled?

Recent research has revealed previously unknown mechanisms in membrane protein assembly, challenging established models. The discovery of internal β-signals functioning alongside the canonical C-terminal β-signal represents one such advancement. When faced with seemingly contradictory data, researchers should:

  • Consider that multiple mechanisms may operate simultaneously or in different contexts

  • Evaluate whether differences reflect protein-specific or organism-specific variations

  • Design experiments that can specifically distinguish between competing models

  • Use computational approaches to simulate different assembly pathways

  • Employ a combination of in vitro and in vivo methodologies to validate findings

What bioinformatic approaches are most valuable for predicting membrane protein function?

For uncharacterized membrane proteins like YeaL, bioinformatic approaches can provide valuable functional insights:

ApproachApplicationLimitations
Homology modelingStructural prediction based on related proteinsRequires suitable templates
Transmembrane topology predictionIdentification of membrane-spanning regionsMay miss subtle structural features
Conserved domain analysisFunctional annotation based on known domainsMay not detect novel domains
Genomic context analysisFunction prediction based on neighboring genesAssumes operonic organization
Phylogenetic profilingFunction prediction based on co-evolutionRequires diverse genome datasets

These approaches should be used in combination and validated experimentally to generate robust functional hypotheses for membrane proteins like YeaL .

How can structural variations in Shigella genomes inform functional studies of membrane proteins?

Genome analysis of Shigella has revealed significant structural variations, including large-scale inversions, deletions, and gene disruptions that appear to be lineage-specific. These variations likely reflect adaptive evolution to different niches and hosts. When studying membrane proteins like YeaL:

  • Compare the genomic context across different Shigella lineages to identify potential co-evolution with other genes

  • Examine whether structural variations affect regulatory elements that might influence expression

  • Determine if the protein has undergone pseudogenization in any lineages, suggesting dispensability in certain contexts

  • Assess whether insertion sequences have disrupted the gene in some isolates

  • Evaluate whether structural variations correlate with phenotypic differences that might suggest function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.