Recombinant Shigella boydii serotype 18 UPF0756 membrane protein YeaL (yeaL) is a genetically engineered antigen derived from the Gram-negative bacterium Shigella boydii, a leading cause of bacillary dysentery. This protein, encoded by the yeaL gene (locus SbBS512_E2042), is part of the UPF0756 family and is expressed in heterologous systems like Escherichia coli for vaccine research and diagnostic applications . Its recombinant form retains structural and immunological properties critical for studying Shigella pathogenesis and developing targeted interventions.
Amino Acid Sequence: Residues 1–148 (MFDVTLLILLGLAALGFISHNTTVAVSILVLIIRVTPLSTFFPWIEQQGLSIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ) .
The yeaL gene is located in S. boydii serotype 18 (strain CDC 3083-94/BS512) and shares genomic clade-specific features. Comparative studies reveal that S. boydii clade 1 contains 98 unique genes, including inner membrane transport components and zinc-binding proteins, which may include yeaL .
Expression System: Optimized in E. coli with yields >90% purity .
Storage: Stable in Tris-based buffer with 50% glycerol at -20°C .
Vaccine Development: Used as an antigen in preclinical studies to elicit immune responses against Shigella .
Diagnostic Tools: Serves as a target for ELISA-based detection of S. boydii infections .
KEGG: sbc:SbBS512_E2042
Shigella boydii is one of four recognized Shigella subgroups, which are human-adapted lineages of Escherichia coli that evolved to cause severe diarrheal disease called shigellosis. S. boydii has 20 distinct serotypes, with type 1 representing the second most prevalent serotype in Bangladesh according to recent epidemiological studies. The World Health Organization has designated Shigella as a priority area for research and development of new therapeutic interventions due to its significant global health impact, particularly in low and middle-income countries .
Shigella species emerged from E. coli following the acquisition of a large virulence plasmid (pINV, 210-240 Kbp) that confers the ability to invade human cells. Throughout their pathoadaptation, Shigella genomes have undergone significant gene loss, primarily associated with insertion sequences (ISs). These small transposable elements can mobilize within the genome, disrupt coding sequences, and mediate genome rearrangements. Each Shigella subgroup harbors significantly more copies of ISs than other E. coli pathotypes, contributing to their genomic plasticity and adaptive evolution .
Membrane proteins, particularly outer membrane proteins (OMPs), are essential components of the Gram-negative bacterial cell envelope. They play crucial roles in nutrient transport, signaling, and maintaining membrane integrity. The assembly of these proteins involves sophisticated machinery, including the β-barrel assembly machinery (BAM) complex. Recent research has revealed that OMPs contain both terminal β-signals and internal β-signals that are recognized by the BAM complex for proper membrane insertion and assembly. While the internal signal-BamD ordering system is not essential for bacterial viability, it is necessary for maintaining outer membrane integrity against antibiotics and environmental stressors .
Successful production of membrane proteins requires careful optimization of growth conditions. Contrary to conventional assumptions, research indicates that the most rapid growth conditions are not necessarily optimal for membrane protein production. Instead, growth under tightly-controlled conditions with harvesting prior to glucose exhaustion (just before the diauxic shift) significantly improves yield. This critical timing appears to be related to the differential expression of genes involved in membrane protein secretion and cellular physiology rather than changes in target gene mRNA levels .
To maximize membrane protein production, high-performance bioreactors should be employed with systematic quantification of cultures under tightly-defined growth regimes. Key parameters to monitor include:
| Parameter | Optimal Range | Impact on Protein Expression |
|---|---|---|
| Growth rate | Moderate (not maximal) | Allows proper protein folding |
| Glucose concentration | Maintain above depletion | Prevents triggering of stress responses |
| Dissolved oxygen | 30-50% saturation | Supports proper protein folding |
| Temperature | Typically 25-30°C | Reduces inclusion body formation |
| pH | 6.5-7.5 | Maintains optimal cellular physiology |
Harvesting cells at precisely the right physiological state (prior to glucose exhaustion) is critical for maximizing functional membrane protein yield .
Complete genome sequencing, particularly using technologies that produce long reads capable of spanning repetitive regions, can provide valuable insights into membrane protein structure and function. For Shigella proteins, whole genome sequencing has revealed phylogenomic diversity and evidence of ongoing adaptive evolution, including structural variations mediated by insertion sequences. These genomic insights can be used to predict transmembrane domains, identify conserved motifs, and understand the evolutionary context of membrane proteins like YeaL. Additionally, comparative genomics across different Shigella lineages can highlight conserved regions that may be functionally significant .
Recent research has challenged the traditional understanding of outer membrane protein assembly by demonstrating that beyond the C-terminal β-signal, internal β-signals also play crucial roles in protein assembly. BamD, an essential subunit of the BAM complex, recognizes both terminal and internal signals, arranging several β-strands and facilitating partial folding for efficient OMP assembly. When designing expression constructs for recombinant membrane proteins, preserving these signal sequences is essential for proper folding and membrane integration. Mutational analysis has shown that alterations to these signals can significantly impair assembly efficiency and membrane integrity .
Phage-based approaches offer innovative methods for membrane protein research. Similar to the phage MK-13 used for specific detection of S. boydii type 1, phages that recognize specific membrane proteins could be isolated and utilized as molecular tools. These phages could be employed for:
| Application | Methodology | Advantage |
|---|---|---|
| Protein detection | Phage-based ELISA | High specificity and sensitivity |
| Functional studies | Phage display | Identification of interaction partners |
| Structural analysis | Cryo-EM of phage-protein complexes | Visualization of native conformations |
| Expression screening | Phage infection assays | Rapid assessment of surface expression |
The specificity of phage-host interactions makes this approach particularly valuable for distinguishing between closely related membrane proteins .
Membrane protein purification represents one of the primary bottlenecks in structural genomics programs. The challenges include:
Low expression levels compared to soluble proteins
Maintaining native conformation during extraction from the membrane
Selecting appropriate detergents that solubilize without denaturing
Preserving stability during concentration and crystallization
Establishing purification protocols that yield homogeneous protein samples
These challenges often necessitate trial-and-error approaches, which frequently yield insufficient amounts for structural studies. Systematic optimization of each purification step is therefore critical for success .
Monitoring protein folding and stability during production is essential for obtaining functional membrane proteins. Methods include:
| Assessment Method | Measured Parameter | Application |
|---|---|---|
| Circular dichroism | Secondary structure content | Rapid screening of folding conditions |
| Fluorescence spectroscopy | Tertiary structure integrity | Detecting conformational changes |
| Size exclusion chromatography | Aggregation state | Assessing homogeneity |
| Thermal shift assays | Protein stability | Optimizing buffer conditions |
| Functional assays | Biological activity | Confirming native conformation |
Each technique provides complementary information about protein quality, helping researchers optimize conditions for maintaining the native state of membrane proteins like YeaL during expression and purification .
Shigella genomes contain numerous insertion sequences that can create challenges for genome assembly and stability of expression constructs. Research has shown that Shigella genomes harbor significantly more copies of ISs than other E. coli pathotypes, contributing to exceptional rates of structural variation. When working with genomic material from Shigella, researchers should consider:
Using long-read sequencing technologies to span repetitive regions
Employing specialized assembly algorithms designed for highly repetitive genomes
Verifying construct stability through multiple passages
Considering synthetic biology approaches to recreate coding sequences without destabilizing elements
Monitoring potential IS-mediated rearrangements during expression
Recent research has revealed previously unknown mechanisms in membrane protein assembly, challenging established models. The discovery of internal β-signals functioning alongside the canonical C-terminal β-signal represents one such advancement. When faced with seemingly contradictory data, researchers should:
Consider that multiple mechanisms may operate simultaneously or in different contexts
Evaluate whether differences reflect protein-specific or organism-specific variations
Design experiments that can specifically distinguish between competing models
Use computational approaches to simulate different assembly pathways
Employ a combination of in vitro and in vivo methodologies to validate findings
For uncharacterized membrane proteins like YeaL, bioinformatic approaches can provide valuable functional insights:
| Approach | Application | Limitations |
|---|---|---|
| Homology modeling | Structural prediction based on related proteins | Requires suitable templates |
| Transmembrane topology prediction | Identification of membrane-spanning regions | May miss subtle structural features |
| Conserved domain analysis | Functional annotation based on known domains | May not detect novel domains |
| Genomic context analysis | Function prediction based on neighboring genes | Assumes operonic organization |
| Phylogenetic profiling | Function prediction based on co-evolution | Requires diverse genome datasets |
These approaches should be used in combination and validated experimentally to generate robust functional hypotheses for membrane proteins like YeaL .
Genome analysis of Shigella has revealed significant structural variations, including large-scale inversions, deletions, and gene disruptions that appear to be lineage-specific. These variations likely reflect adaptive evolution to different niches and hosts. When studying membrane proteins like YeaL:
Compare the genomic context across different Shigella lineages to identify potential co-evolution with other genes
Examine whether structural variations affect regulatory elements that might influence expression
Determine if the protein has undergone pseudogenization in any lineages, suggesting dispensability in certain contexts
Assess whether insertion sequences have disrupted the gene in some isolates
Evaluate whether structural variations correlate with phenotypic differences that might suggest function