Recombinant Shigella boydii serotype 18 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Introduction to yihY Membrane Protein

The UPF0761 membrane protein yihY represents a significant but incompletely characterized protein found in Shigella boydii serotype 18, particularly in strain CDC 3083-94 / BS512. This protein belongs to the broader UPF0761 protein family, which is distributed across various bacterial species including Escherichia coli and other Shigella strains . The designation "UPF" (Uncharacterized Protein Family) indicates that while the protein has been identified and sequenced, its precise biological function remains largely undetermined .

Shigella boydii is one of the causative agents of shigellosis, a severe gastrointestinal disease affecting approximately 270 million individuals globally each year, with particularly high morbidity and mortality in low-income regions . While S. boydii accounts for a relatively small minority of global shigellosis cases and is mainly detected in South Asia, understanding its membrane proteins remains crucial for comprehensive pathogen characterization .

The gene encoding the yihY protein has been identified and is referred to as yihY (gene name) with ordered locus name SbBS512_E4364 in the S. boydii serotype 18 genome . Bioinformatic analyses have suggested potential connections between this protein family and bacterial virulence mechanisms, as evidenced by its classification alongside virulence factor BrkB in some protein databases .

Three-Dimensional Structure

A computed structure model of the yihY protein has been determined and is available in the RCSB Protein Data Bank under the identifier AF_AFB2TVN0F1 . This structure was generated using AlphaFold, a computational method for protein structure prediction. The model demonstrates a global pLDDT (predicted Local Distance Difference Test) score of 78.7, which falls within the "Confident" range (70-90), indicating reasonable reliability of the predicted structure .

Expression Systems and Production Methods

Recombinant Shigella boydii serotype 18 UPF0761 membrane protein yihY is typically produced using E. coli expression systems . The recombinant protein is often engineered with an N-terminal His-tag to facilitate purification through affinity chromatography . The full expression construct includes the complete protein sequence (amino acids 1-290) fused to the purification tag .

The production process involves bacterial expression followed by protein extraction and purification. Due to the membrane-associated nature of the protein, specialized extraction techniques are likely employed to solubilize the protein from bacterial membranes .

Physical and Biochemical Properties

Table 1: Physical and Biochemical Properties of Recombinant yihY Protein

PropertySpecificationReference
Length290 amino acids (full length)
Molecular WeightApproximately 32-35 kDa (estimated)
SourceExpressed in E. coli
TagN-terminal His-tag
Purity>90% as determined by SDS-PAGE
FormLyophilized powder
UniProt IDB2TVN0

Putative Functional Classifications

While the precise function of the yihY protein remains undetermined, bioinformatic analyses have provided several insights into its potential roles. The protein has been classified under multiple functional categories in various databases:

  1. UPF0761 membrane protein family (Hamap classification)

  2. JCVI: YihY family inner membrane protein (NCBIfam classification)

  3. Virulence factor BrkB (Pfam and other classifications)

Comparative Analysis Across Bacterial Species

The yihY protein appears to be conserved across multiple bacterial species, including various serotypes of Shigella and closely related Escherichia coli strains . This conservation suggests functional importance despite the lack of clear functional annotation.

Table 2: Comparison of yihY Protein Across Different Bacterial Species/Strains

Species/StrainUniProt IDSequence LengthSequence SimilarityReference
Shigella boydii serotype 18B2TVN0290 aaReference sequence
Shigella boydii serotype 4Q31UA7290 aaVery high
Shigella sonneiQ3YV90290 aaVery high
Escherichia coliB7L9D9290 aaVery high
Escherichia coli O17:K52:H18B7NFI5290 aaVery high

The high degree of sequence conservation across these bacterial species suggests that the yihY protein likely serves a conserved function in bacterial membrane physiology or potentially in host-pathogen interactions .

Potential Role in Pathogenicity

Shigella boydii causes bacillary dysentery or shigellosis, a significant disease burden in developing nations . While specific experimental evidence connecting the yihY protein directly to virulence is limited, its classification alongside virulence factors and its conserved nature across pathogenic strains merits further investigation .

Recent studies on Shigella pathogenesis have revealed complex mechanisms of host infection, including cell invasion, intracellular replication, and modulation of host immune responses . The potential contribution of membrane proteins like yihY to these processes remains an important area for future research .

Current Research Applications

The recombinant yihY protein is primarily used in fundamental research to understand Shigella biology and pathogenesis . Commercial availability of the purified recombinant protein facilitates various research applications, including:

  1. Structural and functional characterization studies

  2. Development of detection methods and diagnostic tools

  3. Immunological research investigating host-pathogen interactions

  4. Comparative studies across Shigella serotypes and related bacterial species

Potential Applications in Vaccine Development

Recent research has highlighted the potential of Shigella outer membrane proteins and vesicles as targets for vaccination strategies . Outer membrane vesicles (OMVs) from various Shigella species, including S. boydii, have shown promise as vaccine candidates due to their immunomodulatory, antigenic, and adjuvant properties .

While the yihY protein has not been specifically reported as a primary vaccine target in the available search results, membrane proteins from Shigella are generally considered valuable for developing protection against shigellosis . The increasing threat of antibiotic resistance further emphasizes the importance of exploring alternative approaches such as vaccines for managing Shigella infections .

Future Research Directions

Several promising avenues for future research on the yihY protein include:

  1. Detailed functional characterization through gene knockout/knockdown studies

  2. Investigation of protein-protein interactions to identify functional partners

  3. Structural studies using experimental methods such as X-ray crystallography

  4. Evaluation of immunogenicity and potential as a vaccine component

  5. Analysis of expression patterns during different phases of infection

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; SbBS512_E4364; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 membrane protein yihY in Shigella boydii?

The UPF0761 membrane protein yihY is a bacterial membrane protein found in Shigella boydii. It belongs to the Uncharacterized Protein Family (UPF) 0761, indicating that while its sequence has been identified, its precise function remains incompletely characterized. As a membrane protein, it is integrated into the bacterial cell membrane and likely plays a role in membrane integrity, transport, or signaling processes. The protein represents an area of ongoing research in understanding Shigella pathogenicity and bacterial membrane biology.

How does the yihY protein from S. boydii compare structurally to homologous proteins in other Shigella species?

The yihY protein demonstrates structural conservation across Shigella species, reflecting its evolutionary importance. While specific structural data on S. boydii serotype 18 yihY is limited, comparative genomic analyses of Shigella species reveal that membrane proteins often maintain core functional domains while exhibiting variation in surface-exposed regions. This variation may contribute to serotype-specific characteristics, potentially affecting host-pathogen interactions. Unlike the well-characterized virulence factors involved in host cell invasion, the yihY protein's exact structural contributions to S. boydii pathogenicity require further investigation through crystallography and structural biology approaches.

What are the known functional roles of membrane proteins like yihY in Shigella pathogenesis?

Membrane proteins in Shigella species serve diverse functions in pathogenesis, though the specific role of yihY remains under investigation. Generally, bacterial membrane proteins contribute to structural integrity, nutrient acquisition, environmental sensing, and host-pathogen interactions. In Shigella pathogenesis, membrane proteins may participate in survival under gastrointestinal stress conditions, competition with host microbiota, and traversal of intestinal mucus layers—all critical steps that precede the well-studied epithelial cell invasion process . Understanding yihY's function could provide insights into S. boydii's distinct virulence strategies compared to other Shigella species.

What genomic approaches are most effective for analyzing the yihY gene across different S. boydii serotypes?

For effective genomic analysis of the yihY gene across S. boydii serotypes, whole genome sequencing (WGS) combined with targeted sequence analysis offers the most comprehensive approach. Researchers should employ both short-read (Illumina) and long-read (PacBio or Oxford Nanopore) sequencing technologies to ensure complete assembly around the gene region. Comparative genomic analysis using tools like BLAST, MAUVE, or Roary can identify conserved regions and serotype-specific variations. Phylogenetic analysis using maximum likelihood methods is recommended for evolutionary studies. For targeted approaches, PCR amplification with primers designed from conserved flanking regions followed by Sanger sequencing can efficiently assess allelic variations in the yihY gene across different serotypes.

How can researchers optimize recombinant expression systems for the production of S. boydii yihY protein?

Optimizing recombinant expression of S. boydii yihY membrane protein requires systematic evaluation of expression systems tailored to membrane protein characteristics. Consider the following optimization strategy:

  • Expression system selection: Test both prokaryotic (E. coli BL21(DE3), C41(DE3), C43(DE3)) and eukaryotic systems (insect cells, yeast).

  • Vector design: Incorporate fusion tags (His6, MBP, GST) at either N- or C-terminus to facilitate purification while maintaining protein functionality.

  • Codon optimization: Adjust codons to match the host organism's preference, particularly for rare codons.

  • Expression conditions: Evaluate multiple parameters according to Table 1.

Table 1: Optimization Parameters for Recombinant S. boydii yihY Expression

ParameterVariables to TestMonitoring Method
Induction temperature16°C, 20°C, 25°C, 30°CWestern blot, SDS-PAGE
Inducer concentrationIPTG: 0.1-1.0 mMWestern blot, activity assay
Induction duration4h, 8h, 16h, overnightTime-course sampling
Media compositionLB, TB, 2XYT, M9 minimalCell density, protein yield
AdditivesGlycerol (5-10%), glucose (0.5-2%)Membrane integration efficiency
  • Solubilization screening: Test multiple detergents (DDM, LDAO, C12E8) at varying concentrations for optimal extraction from membranes.

What transcriptomic evidence exists for yihY expression under different environmental conditions?

Current transcriptomic data for yihY expression in S. boydii under varying environmental conditions remains limited, creating an opportunity for novel research. RNA-seq analyses of related Shigella species suggest that membrane protein expression, including proteins in the UPF0761 family, may be regulated in response to environmental stressors such as pH changes, osmotic stress, bile exposure, and oxygen limitation—conditions encountered during gastrointestinal passage. Additionally, host-contact simulation experiments indicate potential expression modulation during the infection process. For definitive characterization of yihY expression patterns, researchers should design comprehensive transcriptomic studies examining S. boydii responses to physiologically relevant conditions, using RT-qPCR for targeted validation of expression changes under specific environmental challenges.

What purification strategies yield the highest purity and stability for recombinant S. boydii yihY protein?

Purifying recombinant S. boydii yihY membrane protein requires a specialized approach to maintain protein stability while achieving high purity. A multi-step purification protocol is recommended:

  • Initial extraction: Solubilize membrane fractions using a detergent screening panel (DDM, LDAO, OG) at concentrations just above their critical micelle concentration.

  • Affinity chromatography: Utilize IMAC (immobilized metal affinity chromatography) with Ni-NTA resin for His-tagged constructs, maintaining detergent above CMC throughout all purification steps.

  • Size exclusion chromatography: Apply sample to Superdex 200 or similar column to separate protein-detergent complexes from aggregates and free detergent.

  • Assess purity and stability using the methods in Table 2.

Table 2: Quality Assessment Methods for Purified yihY Protein

MethodParameter MeasuredAcceptance Criteria
SDS-PAGEPurity>95% homogeneity
Western blotIdentitySingle band at expected MW
Dynamic light scatteringMonodispersityPDI <0.2
Thermal shift assayStabilityΔTm >10°C above physiological temperature
SEC-MALSOligomeric stateConsistent molecular weight calculation
CD spectroscopySecondary structureCharacteristic α-helical signature for membrane proteins

For long-term storage, supplement buffer with glycerol (10-20%) and store aliquots at -80°C, avoiding repeated freeze-thaw cycles.

How can researchers effectively design knockout or knockdown studies to investigate yihY function in S. boydii?

Designing effective knockout or knockdown studies for investigating yihY function in S. boydii requires careful methodological planning. For complete gene knockout, the CRISPR-Cas9 system has shown efficacy in Shigella species, though transformation efficiency may be challenging. Design at least three gRNAs targeting different regions of the yihY gene and include appropriate controls, including a scrambled gRNA and complementation strain expressing the wild-type gene to verify phenotype specificity.

For conditional approaches in cases where yihY might be essential, consider an inducible knockdown strategy using antisense RNA or CRISPRi with a dCas9 system. To comprehensively characterize the resulting phenotypes, employ a multi-omics approach examining:

  • Growth kinetics under various environmental conditions

  • Membrane integrity assessment using permeability assays

  • Proteomic analysis to identify compensatory changes in other membrane proteins

  • Transcriptomic profiling to detect regulatory networks affected by yihY depletion

  • Infection models to assess virulence alterations

When interpreting results, carefully distinguish between direct effects of yihY absence and secondary adaptations that may arise during mutant generation.

What are the best approaches for studying protein-protein interactions involving the yihY membrane protein?

Investigating protein-protein interactions involving the membrane-embedded yihY protein requires specialized techniques that preserve the native membrane environment. A multi-technique approach is recommended:

  • In vivo crosslinking with membrane-permeable reagents (DSP, formaldehyde) followed by co-immunoprecipitation can capture transient interactions within the bacterial membrane.

  • Bacterial two-hybrid systems adapted for membrane proteins (BACTH) offer advantages over traditional Y2H systems for transmembrane protein interaction studies.

  • Label-free quantitative proteomics comparing pull-downs from wild-type versus yihY knockout strains can identify interaction partners with statistical confidence.

  • For structural characterization of specific interactions, consider:

Table 3: Advanced Methods for Structural Characterization of yihY Interactions

MethodApplicationStrengthsLimitations
Hydrogen-deuterium exchange MSMaps interaction interfacesWorks in detergent solutionsLimited spatial resolution
Surface plasmon resonanceKinetics of interactionsReal-time binding analysisRequires protein immobilization
Cryo-electron microscopyComplex structure determinationNear-atomic resolution possibleRequires stable complexes
FRET/BRETIn vivo interaction detectionReal-time in living cellsRequires fluorescent protein fusions
Native mass spectrometryIntact complex analysisPreserves non-covalent interactionsChallenging for membrane proteins

Validation across multiple techniques is essential, as each method has inherent biases and limitations.

How does the yihY protein potentially contribute to antimicrobial resistance in S. boydii?

The potential contribution of yihY to antimicrobial resistance in S. boydii remains under investigation, though theoretical mechanisms can be proposed based on its membrane localization. Membrane proteins often influence resistance through several mechanisms: altering membrane permeability to reduce antibiotic uptake, participating in efflux pump complexes, or modifying the membrane potential that drives antibiotic accumulation. Research on related Shigella species has demonstrated that changes in membrane protein expression patterns correlate with resistance development, particularly to antibiotics targeting cell wall synthesis or membrane integrity .

The emergence of multidrug-resistant Shigella strains globally emphasizes the importance of characterizing all membrane components, including yihY, that might contribute to resistance phenotypes. Researchers investigating yihY's role in antimicrobial resistance should perform comparative expression analyses between susceptible and resistant isolates, and conduct antimicrobial susceptibility testing on yihY knockout/overexpression strains against multiple antibiotic classes.

What experimental models are most appropriate for studying S. boydii yihY protein in host-pathogen interactions?

Selecting appropriate experimental models for studying S. boydii yihY in host-pathogen interactions requires consideration of the infection process and potential protein function. A hierarchical approach from in vitro to in vivo models is recommended:

  • Cell culture models:

    • Human intestinal epithelial cell lines (Caco-2, HT-29) for invasion and intracellular survival assays

    • Polarized cell monolayers to investigate epithelial barrier crossing

    • Macrophage cell lines (THP-1, RAW264.7) to assess survival within phagocytic cells

  • Ex vivo models:

    • Human intestinal organoids providing three-dimensional architecture and cell type diversity

    • Intestinal tissue explants maintaining intact mucus layers and tissue architecture

  • In vivo models:

    • Guinea pig keratoconjunctivitis model (Serény test) for virulence assessment

    • Streptomycin-treated mouse model for colonization studies

    • Gnotobiotic piglet model for closest approximation to human infection

When using these models to study yihY specifically, compare wild-type, knockout, and complemented strains, focusing on bacterial survival through gastrointestinal passage, mucus penetration efficiency, and early attachment stages—processes preceding the well-characterized invasion steps highlighted in search result .

How do post-translational modifications affect the function of yihY in S. boydii?

Post-translational modifications (PTMs) of bacterial membrane proteins like yihY can significantly impact their localization, stability, and function, though specific data on yihY modifications in S. boydii is limited. Potential regulatory PTMs that should be investigated include:

  • Phosphorylation: Often regulates bacterial signaling cascades and protein-protein interactions, particularly in environmental response pathways.

  • Glycosylation: Though less common in bacterial proteins than eukaryotic ones, it can affect membrane protein stability and immune recognition.

  • Lipidation: Particularly relevant for membrane proteins, affecting their anchoring and membrane microdomain localization.

To characterize PTMs on yihY, researchers should employ:

Table 4: Techniques for PTM Characterization of yihY Protein

TechniqueApplicationResolutionSample Requirements
LC-MS/MS with ETD/HCD fragmentationComprehensive PTM mappingSite-specificPurified protein, in-gel digestion
Phospho-specific antibodiesPhosphorylation detectionEpitope-specificWestern blotting compatible samples
Pro-Q Diamond/Emerald stainingGlobal phosphorylation/glycosylation detectionGel-basedSDS-PAGE separated proteins
Click chemistryDetection of lipidationSite-specific with modified amino acidsMetabolic labeling in live bacteria
2D-PAGECharge/mass PTM-induced shiftsProtein isoform levelComplex protein mixtures

Research should also investigate how environmental conditions encountered during infection might trigger dynamic changes in yihY modification patterns, potentially altering protein function during different infection stages.

How has the yihY protein evolved across different Shigella species and related Enterobacteriaceae?

Evolutionary analysis of the yihY protein across Shigella species and related Enterobacteriaceae reveals important patterns of conservation and divergence. As Shigella represents a pathovar of E. coli rather than a distinct genus , the yihY protein shows strong sequence homology between Shigella and E. coli strains, typically exceeding 95% amino acid identity. Phylogenetic analysis suggests that yihY predates the divergence of the four Shigella groups, indicating a fundamental role rather than a specialized virulence function.

Comparison across the four Shigella groups (S. flexneri, S. sonnei, S. dysenteriae, and S. boydii) reveals slightly higher sequence variation in surface-exposed regions, potentially reflecting adaptation to different host environments or immune pressures. The core transmembrane domains show higher conservation, suggesting functional constraints. Examining selective pressure through dN/dS ratios indicates primarily purifying selection, consistent with a housekeeping role in membrane integrity rather than a rapidly evolving virulence factor.

What bioinformatic approaches best predict functional domains and potential binding partners of yihY?

Predicting functional domains and potential binding partners of yihY requires an integrated bioinformatic approach combining sequence-based and structure-based methods. Start with transmembrane topology prediction using consensus tools (TMHMM, TOPCONS, and Phobius) to identify membrane-spanning regions versus exposed loops. For functional domain identification, employ:

  • Hidden Markov Model (HMM) searches against domain databases (Pfam, SMART, CDD)

  • Conservation analysis across orthologs to identify functionally constrained residues

  • Structural homology modeling based on crystallized membrane proteins with similar topology

For binding partner prediction, implement:

  • Co-evolution analysis using methods like Direct Coupling Analysis (DCA) or GREMLIN to identify residues potentially involved in protein-protein interactions

  • Genomic context analysis examining conserved operonic structure across bacterial species

  • Protein-protein interaction prediction tools specialized for prokaryotic systems (STRING-db)

  • Molecular docking simulations if structural models are available

Cross-validate predictions using multiple methods, and prioritize experimental validation targets based on confidence scores from consensus predictions.

How do structural variations in yihY correlate with Shigella boydii serotype specificity?

The correlation between yihY structural variations and S. boydii serotype specificity represents an understudied area with potential implications for serotype-specific pathogenicity. While serotyping in Shigella is primarily based on O-antigen variations, membrane proteins can exhibit serotype-associated polymorphisms that may influence bacterial surface properties and host interactions.

Preliminary sequence analyses suggest subtle variations in the extracellular loop regions of yihY across different S. boydii serotypes, while maintaining conserved transmembrane topology. These variations may affect:

  • Surface charge distribution, potentially influencing interactions with host cell receptors

  • Antigenic epitopes that could be recognized by the host immune system

  • Structural flexibility that might adapt the protein to serotype-specific membrane composition

To systematically investigate these correlations, researchers should:

  • Perform comprehensive sequence alignment of yihY across all S. boydii serotypes (1-20)

  • Map variations to predicted structural models

  • Correlate specific polymorphisms with serotype-specific phenotypes

  • Consider horizontal gene transfer events that might have contributed to serotype diversification

Understanding these structure-serotype relationships could provide insights into the molecular basis of S. boydii diversity and its epidemiological implications.

What role might the yihY protein play in developing novel antimicrobial strategies against S. boydii?

The yihY membrane protein represents a potential target for novel antimicrobial strategies against S. boydii, particularly as conventional antibiotics face increasing resistance challenges . As an uncharacterized membrane protein potentially involved in critical cellular processes, yihY offers several therapeutic targeting approaches:

Development of such approaches requires thorough validation of yihY essentiality and function, along with structural characterization to enable rational drug design.

How can structural biology techniques be optimized for membrane proteins like yihY from S. boydii?

Optimizing structural biology techniques for membrane proteins like S. boydii yihY requires addressing the unique challenges these proteins present. An integrated approach combining multiple methods is recommended:

  • X-ray crystallography optimization:

    • Screen detergent-solubilized protein in lipidic cubic phase (LCP) crystallization

    • Test various LCP lipids (monoolein, monopalmitolein) and detergent combinations

    • Implement surface entropy reduction mutations to promote crystal contacts

  • Cryo-electron microscopy enhancements:

    • Utilize nanodiscs or amphipols to maintain native-like lipid environment

    • Implement image processing workflows optimized for smaller membrane proteins

    • Consider symmetry-based reconstruction if yihY forms oligomers

  • NMR spectroscopy approaches:

    • For full structure: Uniformly 13C/15N-label protein and perform TROSY-based experiments

    • For binding studies: Selective labeling of specific amino acids at interfaces

    • Use solid-state NMR for protein reconstituted in lipid bilayers

Table 5: Comparative Analysis of Structural Methods for yihY

Each technique provides complementary information; combining them yields the most comprehensive structural characterization.

What implications does yihY function have for understanding divergent virulence mechanisms among Shigella species?

Understanding yihY function could provide key insights into the divergent virulence mechanisms among Shigella species, particularly relating to their distinct epidemiological patterns. While S. flexneri and S. sonnei dominate in different geographical regions and transmission contexts , less is known about the molecular determinants of S. boydii's specific niche and pathogenicity profile.

Membrane proteins like yihY may contribute to species-specific aspects of:

  • Environmental persistence: Differences in membrane composition and function may explain variable survival in different environmental reservoirs.

  • Host adaptation: The four Shigella groups show distinct host preference patterns that may partially depend on membrane protein interactions with host factors.

  • Immune evasion strategies: Variation in surface-exposed membrane proteins could affect recognition by host immune components.

  • Pre-invasion processes: While invasion mechanisms are well-characterized and relatively conserved , the steps preceding invasion (survival in the gastrointestinal tract, mucus penetration, initial attachment) remain less understood and may involve membrane proteins like yihY.

  • Antimicrobial resistance profiles: The distinct AMR patterns observed across Shigella species may partially depend on membrane protein composition affecting permeability and efflux.

Comprehensive functional characterization of yihY across multiple Shigella species would help construct a more complete model of species-specific pathogenicity mechanisms, potentially informing more targeted intervention strategies.

What are the most common challenges in recombinant expression of S. boydii membrane proteins and how can they be overcome?

Recombinant expression of S. boydii membrane proteins like yihY presents several technical challenges. Here are the most common issues and their solutions:

  • Low expression levels:

    • Implement rare codon optimization for the expression host

    • Test various promoter strengths (T7, tac, ara)

    • Screen multiple E. coli strains specialized for membrane proteins (C41, C43, Lemo21)

    • Consider fusion partners that enhance expression (MBP, SUMO)

  • Protein misfolding and aggregation:

    • Reduce expression temperature (16-20°C)

    • Add folding enhancers to media (glycerol 5-10%, specific lipids)

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Test cell-free expression systems with supplied lipids or detergents

  • Cytotoxicity:

    • Use tightly regulated inducible systems (pET with T7 lysozyme)

    • Implement auto-induction media for gradual protein production

    • Consider mammalian or insect cell expression for highly toxic proteins

  • Poor extraction efficiency:

    • Screen detergent panels systematically (non-ionic, zwitterionic, and mild ionic)

    • Test extraction conditions (temperature, time, buffer composition)

    • Consider native nanodiscs for extraction while maintaining the lipid environment

Maintaining proper controls throughout troubleshooting is critical, including wild-type bacterial expression and fusion tag-only constructs for comparison.

How can researchers resolve conflicting data when characterizing novel membrane proteins like yihY?

Resolving conflicting data when characterizing novel membrane proteins like yihY requires systematic analysis of potential variables influencing experimental outcomes. When faced with contradictory results, implement this resolution framework:

  • Experimental reproducibility assessment:

    • Verify statistical power and replicate consistency

    • Rule out batch effects in reagents or biological materials

    • Implement blinded analysis where appropriate

  • Methodological variations analysis:

    • Document all protocol differences between conflicting studies

    • Systematically test critical variables (detergents, buffer conditions, tags)

    • Consider native versus recombinant protein differences

  • Context-dependent function evaluation:

    • Test protein under varying physiological conditions

    • Assess function in different lipid environments

    • Examine protein modifications across experimental systems

  • Integrated data reconciliation approach:

    • Weigh evidence based on methodological rigor

    • Develop testable hypotheses to explain apparent contradictions

    • Consider that seemingly conflicting results may reveal condition-specific protein behaviors

Table 6: Decision Matrix for Resolving Contradictory Data

Conflict TypeInvestigation ApproachResolution StrategyValidation Method
Functional contradictionsExamine condition dependenciesTest function across environmental gradientsMultiple orthogonal assays
Structural discrepanciesCompare preparation methodsCharacterize in multiple membrane mimeticsCross-method validation
Interaction partner differencesAnalyze detection methodsImplement proximity labeling in native contextReciprocal co-immunoprecipitation
Localization variationsReview fractionation protocolsFluorescent tagging with minimal interferenceImmunoelectron microscopy

When publishing, transparently discuss conflicting data rather than selectively reporting supportive results, as contradictions often lead to deeper mechanistic insights.

What quality control methods should be implemented when working with purified recombinant S. boydii yihY protein?

Implementing rigorous quality control for purified recombinant S. boydii yihY protein is essential for ensuring reliable experimental outcomes. A comprehensive quality control workflow should include:

  • Purity assessment:

    • SDS-PAGE with Coomassie and silver staining (target >95% homogeneity)

    • Western blot confirmation of target protein identity

    • LC-MS peptide mass fingerprinting for definitive identification

  • Structural integrity verification:

    • Circular dichroism spectroscopy to confirm secondary structure composition

    • Thermal stability analysis using differential scanning fluorimetry

    • Limited proteolysis to assess folding quality (properly folded membrane proteins show characteristic resistance patterns)

  • Functional validation:

    • Binding assays for known ligands or interaction partners

    • Activity assays if enzymatic function is known or suspected

    • Reconstitution into liposomes to verify membrane integration

  • Homogeneity analysis:

    • Size exclusion chromatography to assess aggregation state

    • Dynamic light scattering for polydispersity measurement

    • Analytical ultracentrifugation for definitive oligomeric state determination

  • Long-term stability monitoring:

    • Regular reanalysis during storage using methods above

    • Freeze-thaw stability testing if multiple use cycles are planned

    • Accelerated stability studies at elevated temperatures

Document all quality parameters in a standardized format before proceeding with downstream applications, establishing minimum acceptance criteria based on the intended experimental use.

What emerging technologies might advance our understanding of yihY function in S. boydii?

Several emerging technologies hold promise for advancing our understanding of yihY function in S. boydii:

  • Spatial transcriptomics and proteomics:

    • Single-cell bacterial transcriptomics to examine yihY expression heterogeneity

    • Proximity labeling techniques (APEX2, BioID) to map the spatial interactome of yihY in the bacterial membrane

    • Super-resolution microscopy combined with specific labeling to visualize yihY distribution and dynamics

  • Advanced genetic manipulation approaches:

    • CRISPR interference (CRISPRi) for tunable repression of yihY expression

    • Base editing and prime editing for precise mutagenesis without double-strand breaks

    • Inducible degradation systems (AID, SMASh) for temporal control of yihY protein levels

  • Structural and interaction characterization:

    • Cryo-electron tomography of intact bacterial membranes to visualize yihY in native context

    • Hydrogen-deuterium exchange mass spectrometry for mapping dynamic structural changes

    • Native mass spectrometry optimized for membrane protein complexes

  • Functional genomics at scale:

    • Transposon sequencing (Tn-seq) under various stresses to identify genetic interactions

    • Whole-genome chemical genetics to identify small molecules affecting yihY function

    • Bacterial cytological profiling to characterize phenotypic signatures of yihY perturbation

Integration of these technologies with computational modeling approaches will likely yield the most comprehensive insights into yihY's role in S. boydii biology and pathogenesis.

How might comparative studies between S. boydii serotypes inform broader understanding of Shigella pathogenesis?

Comparative studies between S. boydii serotypes represent a valuable approach to understanding broader patterns in Shigella pathogenesis. S. boydii comprises 20 serotypes with varying geographical distribution and clinical presentations, providing a natural experimental system for investigating serotype-specific virulence determinants.

Strategic comparative approaches should include:

  • Genomic comparisons:

    • Pan-genome analysis across all S. boydii serotypes to identify core versus accessory genes

    • Detailed comparison of membrane protein repertoires, including yihY variants

    • Horizontal gene transfer analysis to trace evolutionary acquisition of virulence factors

  • Phenotypic characterization:

    • Standardized virulence assays across serotypes (invasion efficiency, intracellular replication)

    • Antimicrobial resistance profiling to identify serotype-specific patterns

    • Environmental persistence studies under various stress conditions

  • Host-pathogen interaction analysis:

    • Comparative immunostimulatory potential of different serotypes

    • Receptor utilization and tissue tropism variations

    • Inflammatory response profiles elicited by different serotypes

These comparative studies would address fundamental questions in Shigella biology, including:

  • Whether serotype-specific virulence factors complement the core invasion machinery

  • How membrane protein variations contribute to niche adaptation

  • Whether specific serotypes represent evolutionary transitions between virulence strategies

Such knowledge would inform more targeted intervention strategies and contribute to our understanding of bacterial pathoadaptation mechanisms.

What potential biotechnological applications exist for recombinant membrane proteins like S. boydii yihY?

Recombinant membrane proteins like S. boydii yihY offer diverse biotechnological applications beyond basic research:

  • Diagnostic technologies:

    • Development of serotype-specific antibodies targeting unique yihY epitopes

    • Biosensor components for detecting S. boydii in environmental or clinical samples

    • Lateral flow immunoassay targets for rapid point-of-care diagnostics

  • Vaccine development platforms:

    • Recombinant membrane proteins as subunit vaccine candidates

    • Outer membrane vesicle (OMV) vaccines incorporating yihY

    • Adjuvant development based on immunostimulatory properties of bacterial membrane components

  • Drug discovery applications:

    • Target-based screening for novel antimicrobials

    • Development of membrane-protein directed antibody-antibiotic conjugates

    • Structure-based design of peptidomimetics targeting essential membrane proteins

  • Protein engineering platforms:

    • Membrane protein scaffolds for displaying heterologous epitopes

    • Development of stable membrane protein expression systems for difficult targets

    • Creation of hybrid proteins with novel functions by domain swapping

  • Bioremediation and environmental applications:

    • Engineered bacteria expressing modified membrane proteins for metal sequestration

    • Biosensors for environmental monitoring of contaminants

    • Biocatalysts stabilized in membrane environments for industrial processes

These applications leverage the unique properties of membrane proteins while addressing significant needs in infectious disease management, environmental monitoring, and industrial biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.