Recombinant Shigella boydii serotype 18 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Overview of Shigella boydii

Shigella is a genus of bacteria that causes shigellosis, an infection of the intestines . Symptoms of shigellosis include abdominal pain, watery diarrhea, and dysentery . Shigella is a priority area for research and development of new drugs, according to the World Health Organization (WHO) . Immunity to Shigella is serotype-specific, which means accurately distinguishing between serotypes is important .

Shigella boydii is one of the four species of Shigella . In Bangladesh, a study identified 5.4% of all Shigella as S. boydii . Among 793 strains of S. boydii, serotype 12 is the most prevalent, followed by serotypes 1, 4, 14, 18, 5, 11, 8, 2, 13, 15, and 20 .

Zinc Transport Protein ZntB

ZntB is a zinc transport protein. An ELISA (Enzyme-Linked Immunosorbent Assay) kit is available for Shigella boydii serotype 18 Zinc transport protein ZntB(zntB) .

Shigella boydii Serotype 18

Among S. boydii strains, serotype 18 constitutes 7.6% .

Phage-Based Diagnosis of Shigella boydii

Serotype-specific lytic phages are useful for typing Shigella at the serotype level, which makes them a powerful diagnostic tool . Phage typing is a rapid and reproducible technique that requires minimal specialized equipment . A study isolated a phage called MK-13, which specifically lyses S. boydii type 1 but does not lyse other serotypes of Shigella or other enteric bacteria tested .

Shigella boydii Serotype 20

Shigella boydii serotype 20 is a newly emerging serotype . The biochemical reactions of serotype 20 strains are typical of those observed for other S. boydii serotypes .

Table 1: Biochemical Reactions of Shigella boydii Serotype 20

TestResult
MotilityNegative
OxidaseNegative
CatalasePositive
IndoleVariable
Methyl RedPositive
Voges-ProskauerNegative
Simmons’ CitrateNegative
Lysine DecarboxylaseNegative

Table 2: Antimicrobial Resistance of Shigella boydii Serotype 20 Isolates

AntibioticResistant Isolates (%)
Four or more antibiotics90

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless otherwise specified. Please indicate any format requirements in your order for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; SbBS512_E1587; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function

Mediates efflux of zinc ions.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does ZntB differ from other members of the CorA superfamily?

Despite belonging to the same CorA Metal Ion Transporter (MIT) family, ZntB exhibits significant differences from CorA proteins. While CorA functions as a magnesium channel that can collapse into a highly asymmetrical state upon depletion of divalent cations, ZntB maintains its symmetrical pentameric structure even after extensive treatment with EDTA . This structural stability suggests a distinct transport mechanism. Additionally, the surface electrostatic potentials between these proteins differ dramatically, with ZntB from Escherichia coli displaying a strong positive electrostatic surface potential in its cytoplasmic domain compared to the negative potential observed in some homologous structures .

What serotypes of Shigella boydii are most prevalent in clinical settings?

Among the 20 serotypes of Shigella boydii identified in clinical settings, type 1 represents the second most prevalent serotype, particularly in Bangladesh. This finding comes from analysis of 793 clinical S. boydii strains that were serotyped using commercial antisera-kits and type- and group-specific monoclonal antibody reagents . The prevalence data informs researchers about which serotypes should be prioritized in diagnostic and therapeutic development efforts.

What structural conformational changes occur in ZntB during zinc transport?

The transport mechanism of ZntB involves conformational changes within a symmetrical pentameric scaffold. Comparison between the full-length Escherichia coli ZntB structure (obtained in the absence of Zn²⁺) and the structure of the soluble domain of Salmonella typhimurium ZntB (crystallized in the presence of Zn²⁺) reveals significant differences in surface electrostatic potentials and internal pore shapes . These differences likely represent distinct conformational states in the transport cycle.

The charge inversion observed on the pore surface between these two symmetrical states appears to be facilitated by a helical rotation of the transmembrane helix TM1, which contains highly conserved basic and acidic residues on adjacent helical faces . This rotation may create the pathway necessary for zinc transport across the membrane. Further structural studies capturing additional intermediate states would be necessary to fully elucidate the complete transport mechanism.

How can bacteriophages be utilized for specific detection of Shigella boydii serotypes?

Bacteriophages represent a valuable tool for specific detection of bacterial serotypes, particularly in resource-limited settings. For example, phage MK-13 has been isolated that specifically lyses Shigella boydii type 1 but does not lyse other serotypes of Shigella or other enteric bacteria . The isolation procedure involves:

  • Collection of environmental water samples in sterile containers

  • Mixing samples with equal volumes of 2× Luria-Bertani broth and overnight culture of target bacteria

  • Centrifugation at low speed followed by filtration through 0.22-μm pore-sized filters

  • Screening filtered supernatants for phage presence using soft agar overlay technique

  • Purification through serial dilution and repeated infection cycles

  • Host range determination by spotting purified phages onto bacterial lawns

This phage-based approach enables rapid, low-cost diagnosis of specific S. boydii serotypes, especially in remote settings with limited laboratory infrastructure.

What experimental approaches can be used to resolve the controversy regarding ZntB's transport direction?

The directionally of ZntB-mediated zinc transport has been debated, with some studies suggesting an export function while others indicating an import role. To resolve this controversy, researchers can employ multiple complementary approaches:

  • Reconstituted liposome transport assays: By incorporating purified ZntB into liposomes with controlled internal and external environments, researchers can directly measure the direction of zinc movement. Radioisotope (⁶⁵Zn) uptake assays and fluorescent zinc indicators can quantify transport rates under various conditions .

  • pH gradient experiments: Since ZntB functions as a Zn²⁺/H⁺ co-transporter, creating artificial pH gradients across liposomal membranes allows researchers to determine how proton movement influences zinc transport direction .

  • Expression regulation studies: Analysis of ZntB expression in response to varying zinc concentrations provides indirect evidence of function. Downregulation in high zinc environments (as observed in Cupriavidus metallidurans) suggests an import rather than export function .

  • Knockout complementation experiments: Creating knockout strains with well-characterized zinc transporter deletions and complementing with ZntB can help determine its physiological role in zinc homeostasis.

The current body of evidence from these approaches strongly supports that ZntB functions primarily as a zinc importer rather than an exporter .

What are the optimal conditions for expressing and purifying recombinant ZntB from Shigella boydii?

For successful expression and purification of recombinant Shigella boydii ZntB, researchers should consider the following protocol:

  • Expression system selection: E. coli expression systems (particularly BL21(DE3) or C43(DE3) strains) are recommended for membrane protein expression.

  • Vector design: Incorporate an N-terminal or C-terminal affinity tag (His6 or Strep-tag II) with a TEV protease cleavage site for tag removal after purification.

  • Expression conditions:

    • Induce with 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

    • Lower temperature to 20-25°C post-induction

    • Continue expression for 12-16 hours

  • Membrane preparation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by centrifugation at 10,000 × g

    • Isolate membranes by ultracentrifugation at 100,000 × g

  • Solubilization and purification:

    • Solubilize membranes using mild detergents (DDM, LMNG, or UDM)

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Maintain zinc-free conditions using chelating agents when studying apo-state

  • Quality control: Assess protein homogeneity by SDS-PAGE and functional integrity through zinc binding assays .

This systematic approach ensures production of high-quality recombinant protein suitable for structural and functional studies.

What techniques are most effective for studying ZntB-mediated zinc transport in vitro?

Multiple complementary techniques can be employed to study ZntB-mediated zinc transport:

  • Isothermal Titration Calorimetry (ITC): Provides direct measurement of zinc binding parameters including:

    • Binding affinity (Kd)

    • Stoichiometry (n)

    • Thermodynamic parameters (ΔH, ΔS)

  • Liposome reconstitution assays:

    • Incorporation of purified ZntB into liposomes of defined lipid composition

    • Measurement of zinc uptake using radioisotope (⁶⁵Zn) tracers

    • Fluorescent zinc indicators (FluoZin-1, FluoZin-3) for real-time monitoring

  • pH-dependent transport studies:

    • Creation of pH gradients across liposomal membranes

    • Measurement of zinc transport rates at varying pH values

    • Assessment of proton coupling through simultaneous pH measurement

  • Electrophysiological approaches:

    • Planar lipid bilayer recordings

    • Patch-clamp electrophysiology of ZntB-containing proteoliposomes or spheroplasts

These techniques collectively provide comprehensive insights into transport kinetics, energetics, and regulatory mechanisms governing ZntB function .

How can researchers effectively differentiate between Shigella boydii serotypes for experimental studies?

Accurate differentiation between Shigella boydii serotypes is crucial for experimental studies. The following methodology provides a systematic approach:

  • Serological typing:

    • Commercial antisera kits (e.g., Denka Seiken, Tokyo, Japan)

    • Type- and group-specific monoclonal antibody reagents (e.g., Reagensia AB, Stockholm, Sweden)

    • Slide agglutination tests performed after 16-18 hours of incubation on MacConkey agar

  • Molecular typing:

    • PCR-based serotyping targeting O-antigen gene clusters

    • Whole genome sequencing and comparative genomics

    • MLST (Multilocus Sequence Typing) for strain discrimination

  • Phage-based identification:

    • Specific bacteriophages (such as MK-13 for S. boydii type 1)

    • Plaque formation assays using soft agar overlay technique

    • Host range determination across different serotypes

  • Biochemical characterization:

    • API 20E or similar biochemical test panels

    • Carbon source utilization profiles

    • Antibiotic resistance patterns

When combined, these approaches provide robust serotype identification with high specificity and reproducibility, essential for meaningful experimental comparisons across studies.

What aspects of ZntB structure-function relationships remain to be elucidated?

Despite significant advances in understanding ZntB structure and function, several critical knowledge gaps remain:

  • Complete transport cycle: While two conformational states of ZntB have been identified, intermediate states in the transport cycle have yet to be captured structurally. Techniques such as time-resolved cryo-EM or EPR spectroscopy could help elucidate these transitional states .

  • Zinc binding sites: The precise location and coordination geometry of zinc binding sites within the transport pathway need further characterization. Mutational studies combined with ITC and structural analysis would provide valuable insights.

  • Regulatory mechanisms: How ZntB activity is regulated in response to varying zinc concentrations remains poorly understood. Investigation of potential post-translational modifications or interaction partners could reveal regulatory mechanisms.

  • Proton coupling mechanism: While ZntB appears to function as a Zn²⁺/H⁺ co-transporter, the exact stoichiometry and molecular details of this coupling require further investigation through pH-dependent transport studies .

  • Serotype-specific variations: Comparative studies of ZntB from different Shigella boydii serotypes might reveal structural and functional adaptations related to pathogenesis or environmental niches.

Addressing these questions will significantly advance our understanding of zinc transport mechanisms and their role in bacterial physiology.

How might ZntB be targeted for antimicrobial development against Shigella infections?

ZntB represents a potential target for novel antimicrobial strategies against Shigella infections through several approaches:

  • Small molecule inhibitors: Design of competitive or non-competitive inhibitors that bind to critical regions of the ZntB transport pathway could block zinc uptake and compromise bacterial survival. Structure-based drug design utilizing the available structural information would facilitate this approach.

  • Zinc ionophores: Development of compounds that increase intracellular zinc concentrations beyond tolerable levels could exploit the narrow window between essential and toxic zinc concentrations in bacteria.

  • Phage-based approaches: Bacteriophages like MK-13 that specifically target S. boydii could be engineered to deliver ZntB inhibitors or to express CRISPR-Cas systems targeting zntB genes .

  • Peptide inhibitors: Designing peptides that mimic critical interaction interfaces within the ZntB pentamer could disrupt assembly or function of the transporter.

  • Zinc chelators: Selective extracellular zinc chelators could create zinc-limiting conditions that disadvantage pathogens relying on ZntB-mediated zinc acquisition.

These strategies may prove particularly valuable against multidrug-resistant Shigella strains, which represent an increasing global health concern.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.