Recombinant Shigella boydii serotype 4 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Shigella boydii Serotype 4 4-Hydroxybenzoate Octaprenyltransferase (ubiA)

Recombinant Shigella boydii serotype 4 4-hydroxybenzoate octaprenyltransferase (ubiA) is a recombinant protein derived from the ubiA gene of Shigella boydii serotype 4. This enzyme plays a crucial role in the biosynthesis of ubiquinone, a vital component of the electron transport chain in bacteria. The ubiA gene encodes for the enzyme responsible for the first committed step in ubiquinone biosynthesis, transferring a prenyl group from octaprenyl diphosphate to 4-hydroxybenzoate.

Function and Importance of 4-Hydroxybenzoate Octaprenyltransferase

4-Hydroxybenzoate octaprenyltransferase is essential for the synthesis of ubiquinone, which is crucial for the electron transport chain and ATP production in bacteria. This enzyme catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate, a key intermediate in the ubiquinone biosynthesis pathway.

Recombinant Protein Characteristics

The recombinant Shigella boydii serotype 4 4-hydroxybenzoate octaprenyltransferase (ubiA) is available as a recombinant protein product. Key characteristics include:

  • Product Type: Recombinant Protein

  • Species: Shigella boydii serotype 4 (strain Sb227)

  • Uniprot Number: Q31TU8

  • Tag Information: The tag type is determined during production.

  • Storage Buffer: Tris-based buffer with 50% glycerol.

  • Storage Conditions: Store at -20°C for short-term storage or -80°C for long-term storage .

Data Table: Characteristics of Recombinant Shigella boydii Serotype 4 4-Hydroxybenzoate Octaprenyltransferase

CharacteristicsDescription
Product TypeRecombinant Protein
SpeciesShigella boydii serotype 4 (strain Sb227)
Uniprot NumberQ31TU8
Tag InformationDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Storage ConditionsStore at -20°C or -80°C

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
ubiA; SBO_4077; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function

This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.

Database Links

KEGG: sbo:SBO_4077

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.