Recombinant Shigella boydii serotype 4 ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
atpF; SBO_3751; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links

KEGG: sbo:SBO_3751

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) and what role does it play in Shigella boydii?

ATP synthase subunit b, encoded by the atpF gene, is a critical component of the bacterial F₀F₁ ATP synthase complex located in the inner bacterial membrane. In Shigella boydii, including serotype 4, this subunit forms part of the peripheral stalk of the ATP synthase complex, providing structural stability and a physical connection between the F₁ catalytic domain and the F₀ membrane domain. The peripheral stalk that includes subunit b is essential for maintaining the stability of the c-ring/F₁ complex during the rotary mechanism of ATP synthesis . This mechanical stabilization is crucial because it prevents the catalytic F₁ portion from rotating with the c-ring, allowing the enzyme to function as a rotary nanomotor that harnesses the proton gradient across the membrane to synthesize ATP, the primary energy currency of the cell .

ATP synthase in bacteria like Shigella boydii operates by utilizing the proton electrochemical gradient generated across the inner membrane during respiration. Subunit b anchors the stator arm to the membrane and provides the necessary structural framework for the rotary mechanism to function properly. Genetic studies using mutations in ATP synthase subunits have demonstrated that disruption of the atpF gene significantly impairs ATP generation and bacterial growth, confirming its essential role in bacterial energy metabolism .

How does the structure of ATP synthase subunit b from Shigella boydii serotype 4 compare to other bacterial species?

ATP synthase subunit b from Shigella boydii serotype 4 shares significant structural homology with the same subunit in closely related Enterobacteriaceae such as Escherichia coli, reflecting their evolutionary relationship. The protein typically features an N-terminal membrane-anchoring domain embedded in the inner bacterial membrane and an extended alpha-helical domain that projects into the cytoplasm to interact with other components of the stator arm and the F₁ sector. While specific structural data for S. boydii serotype 4 atpF is limited, comparative analyses with E. coli suggest a highly conserved functional architecture.

What is known about the genetic organization and expression regulation of the atpF gene in Shigella boydii serotype 4?

The atpF gene in Shigella boydii serotype 4, like in other Enterobacteriaceae, is typically part of the atp operon that encodes all components of the ATP synthase complex. This operon organization ensures coordinated expression of all subunits required for assembly of the functional ATP synthase complex. In related bacterial systems, the expression of ATP synthase genes is tightly regulated in response to energy demands and environmental conditions, allowing bacteria to optimize their energy production machinery based on available resources.

Research into ATP synthase assembly in bacteria has revealed that expression of mitochondrially encoded subunits (analogous to certain bacterial components) is translationally regulated by the F₁ sector, enabling balanced production of all components . This regulatory mechanism likely applies to Shigella species as well, ensuring stoichiometric assembly of the complex. The expression of ATP synthase genes typically increases during aerobic growth when oxidative phosphorylation is the primary mode of energy generation, while being downregulated under anaerobic or nutrient-limited conditions. This regulation ensures energy efficiency by producing ATP synthase only when conditions favor its operation, which is particularly important for facultative anaerobes like Shigella boydii that must adapt to changing oxygen availability during infection and colonization.

What are the optimal expression systems and conditions for producing recombinant Shigella boydii serotype 4 ATP synthase subunit b?

Based on studies with similar bacterial membrane proteins, E. coli expression systems typically offer the most efficient platform for recombinant production of S. boydii ATP synthase subunit b. BL21(DE3) or C41/C43(DE3) strains, which are specifically engineered for membrane protein expression, provide advantages when expressing potentially toxic membrane proteins like atpF. The expression vector choice should include consideration of fusion tags that facilitate detection and purification while minimizing interference with protein folding and function.

Expression conditions require careful optimization to maximize protein yield while maintaining proper folding. Induction at lower temperatures (16-25°C) often improves the folding of membrane proteins compared to standard 37°C expression. Similarly, using lower inducer concentrations and longer expression times helps prevent formation of inclusion bodies. For the atpF protein specifically, incorporating the protein into the membrane correctly is crucial for maintaining its native conformation. This often necessitates the use of specialized extraction and purification protocols using mild detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain the integrity of membrane protein structure. Additionally, co-expression with chaperone proteins can significantly improve the yield of correctly folded protein by assisting with the folding process during translation.

How can researchers effectively assess the functional integrity of purified recombinant ATP synthase subunit b?

Assessing the functional integrity of recombinant ATP synthase subunit b requires a multi-faceted approach that examines both structural properties and functional interactions. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content and can confirm the expected alpha-helical content characteristic of subunit b. Thermal shift assays can further evaluate protein stability under different buffer conditions, helping optimize storage and handling protocols to maintain functionality.

Beyond structural characterization, functional assessment requires examining the ability of subunit b to correctly interact with other ATP synthase components. In vitro reconstitution assays combining purified subunit b with other ATP synthase subunits can verify proper complex formation through techniques like native gel electrophoresis, size exclusion chromatography, or light scattering. For more detailed interaction studies, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can quantify binding affinities between subunit b and its interaction partners in the ATP synthase complex. The ultimate functional test involves reconstituting the complete ATP synthase complex in liposomes and measuring ATP synthesis/hydrolysis activities in the presence of a proton gradient. Researchers have demonstrated that bacterial ATP release is directly dependent on ATP generation at the inner bacterial membrane, with mutations in subunits of bacterial ATP synthase having significant impacts on ATP generation, growth, and ATP release . This functional relationship provides a basis for assessing whether recombinant subunit b can successfully participate in the complete ATP synthase complex.

What structural analysis techniques are most informative for studying recombinant Shigella boydii ATP synthase subunit b?

Determining the high-resolution structure of membrane proteins like ATP synthase subunit b presents significant technical challenges, requiring a combination of complementary approaches. X-ray crystallography remains the gold standard when crystals of sufficient quality can be obtained, though crystallizing membrane proteins often requires extensive screening of detergents, lipids, and crystallization conditions. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that doesn't require crystallization, allowing visualization of the protein in a more native-like environment within detergent micelles or nanodiscs.

For detailed structural analysis of specific domains, nuclear magnetic resonance (NMR) spectroscopy can be particularly valuable, especially for the soluble portions of subunit b that extend from the membrane. Solution NMR is well-suited for characterizing protein dynamics and identifying flexible regions that may be critical for function but difficult to resolve in static structural techniques. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides complementary information about protein dynamics and solvent accessibility, helping map interaction surfaces with other ATP synthase components. Cross-linking mass spectrometry (XL-MS) can capture spatial relationships between subunit b and its binding partners, providing constraints for modeling the intact ATP synthase complex. This multi-technique approach is essential because no single method can fully capture the structural complexity of membrane proteins like ATP synthase subunit b in both its isolated form and its native complex.

How does ATP synthase subunit b contribute to bacterial ATP release and what are the implications for Shigella pathogenesis?

Recent research has revealed that ATP synthase plays a crucial role in bacterial ATP release, with significant implications for host-pathogen interactions. Studies using E. coli mutants of ATP synthase subunits, including atpF (which encodes subunit b), have demonstrated that ATP release is directly dependent on ATP synthesis at the inner bacterial membrane . Mutations in ATP synthase subunits result in significantly lower ATP release compared to mutations in other respiratory chain components like cytochrome bo3 oxidase subunits . This suggests that intact ATP synthase function, including properly assembled subunit b, is essential for normal ATP release patterns in gram-negative bacteria like Shigella boydii.

The extracellular ATP released by bacteria has been shown to modulate host immune responses during infection. In mouse models of abdominal sepsis, bacterial ATP was found to suppress local immune responses, resulting in reduced neutrophil counts and impaired survival . For Shigella boydii infections, this immunomodulatory effect of released ATP could potentially contribute to pathogenesis by helping the bacteria evade initial host defenses. Additionally, bacterial ATP can be transported throughout the body via outer membrane vesicles (OMVs), exerting systemic effects that may include altered neutrophil function and possible exacerbation of sepsis severity . These findings suggest that ATP synthase, including subunit b, may represent an underappreciated virulence factor in Shigella infections, potentially opening new avenues for therapeutic intervention targeting bacterial ATP production and release.

What experimental approaches can differentiate the role of ATP synthase subunit b in Shigella boydii compared to other enteric pathogens?

Comparative functional genomics provides a powerful approach for differentiating the specific roles of ATP synthase subunit b across enteric pathogens. Creating isogenic mutants in the atpF gene across different pathogens, including various serotypes of Shigella boydii and related Enterobacteriaceae, allows direct comparison of phenotypic effects on growth, ATP production, and virulence. Complementation studies using atpF genes from different species expressed in a common genetic background can further determine whether functional differences are intrinsic to the protein sequence or result from different genetic contexts.

Experimental infection models offer crucial insights into pathogen-specific roles of ATP synthase. Both in vitro cell culture infection models and in vivo animal models of Shigella infection can be used to compare wild-type and atpF mutant strains, assessing parameters such as intracellular survival, host cell damage, and immune response modulation. Particularly informative are competitive infection assays where wild-type and mutant bacteria compete within the same host, directly revealing fitness differences. Recent studies have established important connections between bacterial ATP release and inflammation, demonstrating that ATP released by bacteria shapes both local and systemic inflammatory responses . Specifically engineered Shigella strains expressing periplasmic apyrase to hydrolyze ATP before release provide a sophisticated tool for determining how ATP release affects pathogenesis in different enteric pathogens. These comparative approaches can reveal whether ATP synthase subunit b has evolved unique properties in Shigella boydii serotype 4 that contribute to its specific pathogenicity profile.

Experimental ApproachApplication to ATP Synthase Subunit b ResearchKey Outcome Measures
Site-directed mutagenesisAlter specific residues in atpF geneATP synthesis activity, complex assembly, growth phenotypes
Complementation studiesExpress heterologous atpF genes in mutant backgroundFunctional conservation across species/serotypes
Protein-protein interaction assaysMap interaction partners of subunit bAssembly dependencies, complex stability
In vitro reconstitutionCombine purified components to rebuild ATP synthaseEnzymatic activity in controlled conditions
Infection modelsCompare wild-type vs. atpF mutant virulenceColonization, persistence, immune responses
ATP release quantificationMeasure extracellular ATP levelsCorrelation with growth phase and membrane integrity

How does the assembly pathway of ATP synthase incorporating subunit b in Shigella boydii inform potential antimicrobial targeting strategies?

The assembly of bacterial ATP synthase follows a coordinated pathway where proper incorporation of subunit b is critical for complex stability and function. Research on ATP synthase assembly in related bacteria suggests this process involves distinct assembly modules: the c-ring, F₁, and the Atp6p/Atp8p complex (in mitochondrial systems) . The peripheral stalk, which includes subunit b, is crucial for stabilizing the c-ring/F₁ complex, essentially providing the static framework against which the rotary components can turn . This complex, multi-step assembly process presents several potential vulnerability points that could be exploited for antimicrobial development.

Targeting protein-protein interactions specific to ATP synthase assembly represents a promising antimicrobial strategy. Small molecules designed to interfere with the binding interface between subunit b and other components of the peripheral stalk could prevent proper complex formation, leading to non-functional ATP synthase and energy depletion. Studies comparing ATP synthase assembly across different bacterial species have identified both conserved and species-specific features of this process . Focusing on interactions that are essential in Shigella but different in human mitochondrial ATP synthase could yield selective inhibitors. Additionally, compounds that destabilize already assembled complexes by binding to accessible regions of subunit b could disrupt energy production in established infections. The correlation between ATP synthase function, bacterial growth, and ATP release suggests that such inhibitors would not only affect bacterial viability but might also modulate host-pathogen interactions by altering extracellular ATP levels during infection.

What are the key considerations for designing genetic manipulation experiments targeting the atpF gene in Shigella boydii serotype 4?

When designing genetic manipulation experiments targeting the atpF gene in Shigella boydii serotype 4, researchers must carefully consider the essential nature of ATP synthase for bacterial viability. Complete deletion of atpF typically results in severe growth defects, potentially limiting experimental applications . Instead, conditional expression systems using inducible promoters provide greater experimental flexibility, allowing controlled attenuation of atpF expression. This approach enables the study of partial loss of function phenotypes that may be more informative about the protein's role in pathogenesis than complete knockout strains.

Site-directed mutagenesis offers a more nuanced approach to studying specific functional domains of subunit b. Strategic mutations can target the membrane-anchoring domain, the dimerization interface, or interaction surfaces with other ATP synthase components. When designing such mutations, conservation analysis across multiple bacterial species helps identify functionally critical residues. For more sophisticated genetic manipulations, allelic exchange methods that leave no antibiotic resistance markers are preferable, as they minimize polar effects on downstream genes in the atp operon. CRISPR-Cas9 based genome editing has emerged as a particularly effective approach for creating scarless mutations in bacterial pathogens like Shigella. Regardless of the genetic manipulation strategy chosen, phenotypic verification should include comprehensive assessments of growth rates, ATP production, complex assembly, and relevant virulence traits to fully characterize the functional consequences of atpF modifications.

What purification challenges are specific to recombinant Shigella boydii ATP synthase subunit b and how can they be addressed?

Purification of recombinant ATP synthase subunit b presents several challenges due to its membrane association and structural characteristics. The hydrophobic N-terminal domain that anchors the protein to the membrane can cause aggregation during extraction and purification, while the elongated alpha-helical structure may be susceptible to proteolytic degradation. Addressing these challenges requires careful optimization at each step of the purification process to maintain protein integrity and functionality.

Effective solubilization represents the first critical step, requiring screening of different detergents to identify those that efficiently extract subunit b while preserving its native conformation. Mild detergents like DDM, LMNG, or digitonin are often suitable starting points. Once solubilized, purification typically employs affinity chromatography using carefully positioned tags that don't interfere with protein folding or function. For ATP synthase subunit b, C-terminal tags are generally preferable to avoid disruption of the membrane-anchoring N-terminus. Following initial affinity purification, size exclusion chromatography helps remove aggregates and ensure homogeneity of the preparation. Throughout the purification process, stability can be enhanced by including appropriate lipids that mimic the native membrane environment and stabilize the protein's structure. For long-term storage and functional studies, reconstitution into nanodiscs or liposomes often provides a more native-like environment than detergent micelles. This methodical approach addressing the specific physicochemical properties of subunit b maximizes the likelihood of obtaining pure, functional protein suitable for structural and functional characterization.

Purification ChallengePotential SolutionsQuality Assessment Method
Membrane extractionDetergent screening (DDM, LMNG, digitonin)SDS-PAGE, Western blot
Protein aggregationAddition of stabilizing agents (glycerol, specific lipids)Size exclusion chromatography profiles
Proteolytic degradationInclusion of protease inhibitors, low-temperature handlingMass spectrometry integrity analysis
Protein heterogeneityMulti-step chromatography (affinity, ion exchange, size exclusion)Dynamic light scattering, native PAGE
Detergent interference with assaysDetergent exchange or reconstitution into nanodiscs/liposomesFunctional assays with control proteins

How should researchers design experiments to investigate the role of ATP synthase subunit b in bacterial ATP release mechanisms?

Investigating the relationship between ATP synthase subunit b and bacterial ATP release requires carefully designed experiments that can distinguish between direct mechanistic involvement and indirect effects resulting from altered energy metabolism. Genetic approaches should include both complete knockout mutants and site-directed mutants targeting specific functional domains of subunit b to determine which aspects of the protein are critical for ATP release. Complementation studies with wild-type atpF or mutant variants can confirm specificity of observed phenotypes and rule out polar effects on other genes.

For quantitative assessment of ATP release, luciferin-luciferase based assays provide sensitive real-time monitoring of extracellular ATP levels . When applying these assays, researchers should measure both bacterial growth and ATP release simultaneously to account for the correlation between these parameters . Time-course experiments are essential, as ATP release has been shown to be growth phase-dependent, typically peaking during exponential growth . Additionally, experiments should assess membrane integrity using appropriate indicators, as impaired outer membrane integrity can significantly contribute to ATP release through passive leakage rather than regulated mechanisms . To investigate the physiological relevance of ATP release mediated by ATP synthase, researchers can employ specialized tools such as bacteria expressing periplasmic apyrase that hydrolyzes ATP before release . This approach allows direct assessment of how bacterial ATP affects host-pathogen interactions in infection models. Through these multifaceted experimental approaches, researchers can dissect both the mechanistic basis of ATP release involving subunit b and its biological significance in Shigella pathogenesis.

How can structural knowledge of ATP synthase subunit b be applied to vaccine development against Shigella boydii?

ATP synthase subunit b represents a potential target for vaccine development against Shigella boydii due to its essential nature, conservation across strains, and restricted localization primarily to the bacterial membrane. While the membrane-embedded portions are largely inaccessible to antibodies, the extended cytoplasmic domain may contain portions that become exposed during infection or cell lysis. Epitope mapping studies can identify immunogenic regions of subunit b that elicit protective antibody responses, focusing particularly on segments that may be accessible during different stages of infection.

For vaccine development, recombinant expression of specific antigenic domains from ATP synthase subunit b, rather than the full protein, may offer advantages by focusing immune responses on the most relevant epitopes while avoiding potential complications from the hydrophobic regions. These antigens could be incorporated into various vaccine platforms, including subunit vaccines, virus-like particles, or as components of broader multiepitope constructs targeting multiple Shigella antigens. The potential involvement of ATP synthase in bacterial ATP release, which has been shown to modulate host immune responses , adds another dimension to consider in vaccine design. If antibodies against subunit b can interfere with ATP release, this could potentially enhance host defense mechanisms by preventing bacteria from suppressing local immune responses. Preclinical evaluation would need to carefully assess both direct bactericidal activity of anti-atpF antibodies and their potential to neutralize immunomodulatory effects of bacterial ATP during infection.

What is the potential for targeting ATP synthase subunit b with novel antimicrobial agents?

ATP synthase represents an attractive antimicrobial target due to its essential role in bacterial energy metabolism. Subunit b, as a component of the peripheral stalk, offers unique targeting opportunities based on its role in maintaining the structural integrity of the complex. Experimental evidence with ATP synthase mutants, including atpF mutants, has demonstrated significant growth impairment when this complex is compromised , validating it as a potential antimicrobial target. Structure-based drug design approaches can leverage detailed knowledge of subunit b to develop compounds that specifically interfere with its integration into the ATP synthase complex or its interactions with other subunits.

Several potential targeting strategies exist for ATP synthase subunit b. Small molecules that bind to interaction interfaces between subunit b and other complex components could prevent proper assembly, resulting in non-functional ATP synthase. Alternatively, compounds that induce conformational changes in already assembled complexes could disrupt the precise spatial relationships required for rotary catalysis. Peptide-based inhibitors mimicking critical interface regions offer another approach, potentially providing greater specificity than small molecules. The challenge in targeting bacterial ATP synthase lies in achieving selectivity over human mitochondrial ATP synthase. Comparative structural analysis between bacterial and human ATP synthase can identify subtle differences in subunit b that could be exploited for selective targeting. Additionally, the relationship between ATP synthase function and bacterial ATP release suggests that partial inhibition of ATP synthase might modulate pathogenesis by altering extracellular ATP levels without requiring complete killing of bacteria, potentially reducing selective pressure for resistance development.

How might advances in synthetic biology enable new applications utilizing recombinant ATP synthase components from Shigella boydii?

Synthetic biology approaches offer exciting possibilities for harnessing recombinant ATP synthase components, including subunit b from Shigella boydii, for novel biotechnological applications. The ATP synthase complex functions essentially as a biological rotary nanomotor, converting the energy of proton gradients into mechanical rotation and ultimately chemical energy in the form of ATP. This remarkable molecular machine can potentially be repurposed for various synthetic applications by recombining components from different sources or engineering modified versions with altered properties.

One promising direction involves creating hybrid ATP synthase complexes incorporating subunit b from Shigella boydii with components from other organisms to achieve specific functional properties. These could include enhanced stability under industrial conditions, altered ion specificity, or modified regulatory responses. Another application area is the development of biosensors utilizing ATP synthase components. Engineering reporter elements into subunit b that respond to conformational changes during ATP synthesis could create sensitive detection systems for monitoring energy metabolism or testing compounds that affect ATP synthase function. Perhaps most ambitiously, the rotary mechanism of ATP synthase could be harnessed for nanoscale mechanical applications, potentially using subunit b as a structural element in synthetic nanomachines. By understanding the specific properties of Shigella ATP synthase components, including the atpF-encoded subunit b, researchers can expand the toolkit available for synthetic biology applications ranging from bioenergy production to nanomedicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.