Recombinant Shigella boydii serotype 4 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SBO_1818; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEIVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links

KEGG: sbo:SBO_1818

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of cardiolipin synthase in Shigella species?

Cardiolipin synthase (Cls) in Shigella species is responsible for the synthesis of cardiolipin, a crucial phospholipid component of bacterial membranes. Based on studies with related Shigella flexneri, the primary cardiolipin synthase (ClsA) catalyzes the condensation of two phosphatidylglycerol molecules to produce cardiolipin . This phospholipid is essential for proper membrane function and, notably, for virulence in pathogenic Shigella strains. The cls gene product contributes significantly to bacterial survival during host infection by enabling proper cell division, maintaining membrane integrity, and supporting various cellular processes that rely on functional membrane composition. Cardiolipin synthesis represents a critical aspect of bacterial phospholipid metabolism with direct implications for pathogenesis.

How do the different cardiolipin synthases (ClsA, ClsB, ClsC) in Shigella species compare functionally?

In Shigella species, three distinct cardiolipin synthases have been identified with differing functional contributions:

EnzymePrimary FunctionSynthesis MechanismGrowth Phase ActivityContribution to Total CL
ClsAMajor CL synthaseCondenses two phosphatidylglycerol moleculesActive during exponential and stationary phases~90-100% during exponential phase
ClsBMinor CL synthaseCondenses two phosphatidylglycerol moleculesLimited activity detected under standard conditionsMinimal under standard conditions
ClsCSecondary CL synthaseCondenses phosphatidylglycerol and phosphatidylethanolaminePrimarily active during stationary phase~10% during stationary phase

Studies with Shigella flexneri have demonstrated that ClsA is predominantly responsible for cardiolipin synthesis during exponential growth, with deletion of clsA resulting in the absence of detectable cardiolipin and compensatory increases in phosphatidylglycerol levels . Interestingly, ClsC becomes active during stationary phase growth, as evidenced by detection of approximately 1% cardiolipin in clsA mutants during stationary phase. Only the clsA clsC double mutant completely lacks cardiolipin during stationary phase, confirming ClsC's contribution to stationary phase cardiolipin synthesis . These functional differences highlight the evolutionary adaptation of Shigella to maintain cardiolipin synthesis under varying growth conditions.

What are the optimal conditions for recombinant expression of Shigella boydii cardiolipin synthase?

For optimal recombinant expression of Shigella boydii cardiolipin synthase, the following methodological approach is recommended:

Expression System:
E. coli is the preferred heterologous expression system, as demonstrated by successful expression of full-length S. boydii serotype 18 cardiolipin synthase (486 amino acids) with N-terminal His-tag . BL21(DE3) or similar E. coli strains are recommended for high-level protein expression.

Expression Vector Construction:

  • Clone the full-length cls gene (1-486 amino acids) into an expression vector containing an N-terminal His-tag

  • Use a T7 or similar strong promoter system for inducible expression

  • Verify construct integrity by sequencing before transformation

Culture Conditions:

  • Medium: LB or 2xYT supplemented with appropriate antibiotics

  • Temperature: 30°C (post-induction) to minimize inclusion body formation

  • Induction: 0.1-0.5 mM IPTG when OD600 reaches 0.6-0.8

  • Post-induction growth: 4-6 hours at 30°C or overnight at 20°C

Protein Purification:

  • Harvest cells and lyse using sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Purify using Ni-NTA affinity chromatography

  • Elute with imidazole gradient (50-250 mM)

  • Further purify by size exclusion chromatography if higher purity is required

  • Lyophilize in buffer containing 6% trehalose as a stabilizer

Storage:
Store lyophilized protein at -20°C/-80°C. For reconstituted protein, add 5-50% glycerol (final concentration) and store at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles .

How can cardiolipin synthase activity be reliably measured in laboratory settings?

Measuring cardiolipin synthase activity requires specialized techniques to detect the conversion of phosphatidylglycerol to cardiolipin. Here are validated methodological approaches:

1. Thin-layer Chromatography (TLC) Method:

  • Extract total lipids from bacterial membranes using Bligh-Dyer phospholipid isolation

  • Separate phospholipids by TLC on silica gel plates

  • Develop plates using chloroform:methanol:acetic acid (65:25:10, v/v/v)

  • Visualize phospholipids using iodine vapor or phosphomolybdic acid staining

  • Quantify cardiolipin and phosphatidylglycerol bands by densitometry

2. Radioactive Assay:

  • Prepare membrane fractions containing cardiolipin synthase

  • Incubate with 14C or 32P-labeled phosphatidylglycerol

  • Stop reaction and extract lipids using chloroform/methanol

  • Separate products by TLC and quantify radioactive cardiolipin by autoradiography or scintillation counting

3. Fluorescence-based Assay:

  • Use fluorescently labeled phosphatidylglycerol analogs as substrates

  • Monitor reaction progress by HPLC with fluorescence detection

  • Calculate enzyme activity from the rate of product formation

4. Mass Spectrometry Method:

  • Incubate enzyme with substrate in appropriate buffer

  • Extract lipids and analyze by LC-MS/MS

  • Identify and quantify cardiolipin and phosphatidylglycerol using multiple reaction monitoring

  • Calculate enzyme activity based on cardiolipin formation over time

When comparing wild-type and mutant enzymes, maintain identical reaction conditions and include appropriate controls. Typical reaction buffers contain 50 mM Tris-HCl (pH 7.5), 10 mM MgCl2, and 50-100 μM phosphatidylglycerol in detergent micelles or liposomes.

How does cardiolipin distribution between inner and outer membranes affect Shigella virulence?

The distribution of cardiolipin between the inner and outer membranes has profound implications for Shigella virulence. Studies with Shigella flexneri have revealed several critical aspects of this relationship:

Cardiolipin is present in both the inner and outer membranes of Shigella, with similar phospholipid distributions in both membrane compartments . This dual localization is functionally significant as it affects multiple virulence determinants:

  • Actin-based Motility: Cardiolipin in the outer membrane is required for proper localization of IcsA (VirG), a key protein that mediates actin polymerization and intracellular motility. Without cardiolipin in the outer membrane, IcsA is improperly distributed on the bacterial surface, compromising bacterial motility and cell-to-cell spread .

  • Cell-to-Cell Spread: Mutations in either cardiolipin synthesis (clsA) or transport (pbgA) result in failure to form plaques in epithelial cell monolayers, indicating defective cell-to-cell spread. Specifically:

    • The clsA mutant (lacking cardiolipin in both membranes) is initially motile within host cells but forms filaments, loses motility during replication, and fails to spread efficiently .

    • The pbgA mutant (lacking cardiolipin specifically in the outer membrane) has normal replication but cannot properly localize IcsA and fails to spread .

  • Compensatory Mechanisms: When cardiolipin is absent from the outer membrane, increased phosphatidylglycerol can partially compensate, allowing some IcsA localization, but this is insufficient for full virulence .

The transport of cardiolipin from the inner to the outer membrane is mediated by PbgA (YejM), and mutation of the pbgA gene results in cardiolipin being present only in the inner membrane. This selective absence from the outer membrane is sufficient to compromise virulence, demonstrating that the specific localization of cardiolipin in the outer membrane is critical for pathogenesis .

These findings highlight that both the synthesis of cardiolipin by ClsA and its proper transport to the outer membrane by PbgA are essential for full Shigella virulence.

What are the molecular consequences of cardiolipin deficiency in bacterial systems?

Cardiolipin deficiency in bacterial systems produces distinct molecular and physiological consequences that affect multiple cellular processes:

Membrane Structure and Function:

  • Altered phospholipid composition with compensatory increases in phosphatidylglycerol levels

  • Compromised membrane organization affecting protein localization and function

  • Potential changes in membrane fluidity and permeability

Cell Division and Morphology:

  • Formation of filamentous cells during replication within host cells

  • Disruption of proper septum formation during division

  • Aberrant cell morphology due to altered membrane properties

Protein Localization:

  • Improper localization of outer membrane proteins that depend on cardiolipin-rich domains

  • Specific mislocalization of virulence factors such as IcsA in Shigella flexneri

  • Potential effects on membrane protein complexes that require cardiolipin for stability

Energy Metabolism:

  • In eukaryotic systems, cardiolipin deficiency affects mitochondrial respiratory complexes III and IV

  • Similar effects might occur in bacterial respiratory chains

  • Potential reduction in ATP synthesis efficiency

Stress Tolerance:

  • Reduced ability to adapt to environmental stresses (pH, osmotic, oxidative)

  • Compromised membrane integrity under stress conditions

  • Altered ability to form protective biofilms

Virulence Manifestations:

  • Loss of intracellular motility and cell-to-cell spread in Shigella

  • Inability to establish productive infections despite normal invasion capacity

  • Reduced survival within host cells

The molecular consequences of cardiolipin deficiency are context-dependent, varying with bacterial species, growth conditions, and specific mutations. While some bacteria can partially compensate for cardiolipin loss through increased phosphatidylglycerol production , others show more severe phenotypes, particularly under stress conditions or during host infection.

How do bacterial cardiolipin synthases differ from eukaryotic counterparts, and what are the implications for antimicrobial development?

Bacterial and eukaryotic cardiolipin synthases exhibit fundamental differences in structure, mechanism, and regulation that present potential opportunities for selective antimicrobial targeting:

Structural and Mechanistic Differences:

FeatureBacterial Cardiolipin SynthasesEukaryotic Cardiolipin Synthases
Reaction mechanismCondensation of two phosphatidylglycerol molecules (ClsA/B) or phosphatidylglycerol and phosphatidylethanolamine (ClsC) CDP-DAG pathway using phosphatidylglycerol and CDP-diacylglycerol
Protein familyPhospholipase D superfamilyCDP-alcohol phosphatidyltransferase family
Catalytic domainsHKD motifs for phosphodiester bond formationConserved motif D-G-(X)2-A-R-(X)8-G-(X)3-D-(X)3-D
Membrane topologyMultiple transmembrane segmentsComplex transmembrane arrangement
Gene redundancyMultiple cls genes (clsA, clsB, clsC) with partial functional overlap Typically single CLS gene with tissue-specific isoforms

Evolutionary Significance:
Some eukaryotic organisms, notably Trypanosoma brucei, possess bacterial-type cardiolipin synthases despite their eukaryotic nature, suggesting evolutionary gene transfer events . This reveals the complex evolutionary history of these enzymes and highlights potential diversity in eukaryotic cardiolipin synthesis mechanisms.

Implications for Antimicrobial Development:

  • Selective Targeting: The distinct structural and mechanistic differences between bacterial and human cardiolipin synthases provide opportunities for developing selective inhibitors that target bacterial enzymes without affecting mammalian counterparts.

  • Essential Function: Cardiolipin synthase is essential for virulence in pathogens like Shigella , making it a promising antimicrobial target, particularly for diseases where bacterial spread within host cells is critical.

  • Broad-Spectrum Potential: Cardiolipin synthase inhibitors could potentially have broad-spectrum activity against multiple bacterial pathogens that rely on cardiolipin for virulence.

  • Resistance Considerations: The presence of multiple cls genes with partial functional redundancy might present challenges for antimicrobial development due to potential compensatory mechanisms, particularly during stationary phase growth .

  • Combination Therapy Opportunity: Inhibitors targeting both cardiolipin synthesis and transport (PbgA) could provide synergistic effects by preventing both the production and proper localization of cardiolipin.

  • Target Validation: Genetic studies demonstrating the importance of cardiolipin for bacterial virulence provide strong validation for cardiolipin synthase as an antimicrobial target.

The fundamental differences between bacterial and eukaryotic cardiolipin synthases make this enzyme family a promising target for novel antimicrobial development, particularly for intracellular pathogens like Shigella species.

What analytical approaches can resolve contradictory findings about cardiolipin's role in membrane organization and protein interaction?

Resolving contradictory findings about cardiolipin's role in membrane organization and protein interactions requires sophisticated analytical approaches that address the complexity of membrane systems. The following methodological framework can help researchers navigate conflicting results:

1. Comprehensive Membrane Fractionation and Analysis:

  • Employ Sarkosyl solubilization to cleanly separate inner and outer membranes

  • Validate separation using membrane-specific markers (e.g., SecA for inner membrane, OmpA for outer membrane)

  • Analyze phospholipid composition using multiple complementary techniques:

    • Thin-layer chromatography with diverse solvent systems

    • Mass spectrometry-based lipidomics for detailed molecular species analysis

    • Fluorescence microscopy with cardiolipin-specific dyes

2. Genetic Approaches with Fine Resolution:

  • Create single and combinatorial mutations in all cardiolipin synthase genes (clsA, clsB, clsC)

  • Generate conditional knockouts to control the timing of cardiolipin depletion

  • Employ site-directed mutagenesis to target specific functional domains

  • Use complementation studies with wild-type and mutant alleles to validate phenotypes

3. Advanced Biophysical Methods:

  • Solid-state NMR to analyze cardiolipin interactions with proteins in native membranes

  • Surface plasmon resonance to quantify binding kinetics and affinities

  • Atomic force microscopy to visualize membrane domain organization

  • Förster resonance energy transfer (FRET) to detect protein-lipid interactions in real-time

4. Functional Assays with Controlled Variables:

  • Reconstitute membrane proteins in liposomes with defined cardiolipin content

  • Systematically vary cardiolipin concentration and acyl chain composition

  • Measure protein activity, oligomerization, and stability across conditions

  • Correlate functional outcomes with specific cardiolipin properties

5. Contextual Considerations for Data Interpretation:

  • Growth phase effects: Compare exponential versus stationary phase cells

  • Species-specific differences: Distinguish between Shigella, E. coli, and other bacterial models

  • Environmental influences: Assess pH, temperature, osmolarity effects on cardiolipin-protein interactions

  • Compensatory mechanisms: Analyze how increased phosphatidylglycerol might mask cardiolipin deficiency effects

6. Computational and Modeling Approaches:

  • Molecular dynamics simulations of cardiolipin-protein interactions

  • Statistical analysis of conflicting datasets to identify experimental variables driving differences

  • Development of predictive models for cardiolipin binding and functional impact

By implementing this multi-faceted analytical framework, researchers can systematically address variables that may underlie contradictory findings, ultimately developing a more nuanced understanding of cardiolipin's diverse roles in bacterial membrane organization and protein interactions.

What strategies can overcome common challenges in purifying active recombinant cardiolipin synthase?

Purifying active recombinant cardiolipin synthase presents several challenges due to its membrane-associated nature. The following strategies address common obstacles encountered during purification and help maintain enzyme activity:

Challenge 1: Poor Expression Levels

  • Solution: Optimize codon usage for expression host (typically E. coli)

  • Solution: Test multiple expression vectors with different promoter strengths

  • Solution: Screen various E. coli strains (BL21(DE3), C41(DE3), C43(DE3) for membrane proteins)

  • Solution: Reduce induction temperature to 16-20°C and extend expression time

Challenge 2: Protein Insolubility/Inclusion Body Formation

  • Solution: Express protein with solubility-enhancing tags (MBP, SUMO, TrxA)

  • Solution: Optimize induction conditions (reduce IPTG concentration to 0.1 mM)

  • Solution: Add 0.5-1% glucose to media to reduce basal expression before induction

  • Solution: If inclusion bodies form, develop refolding protocols using gradual dialysis

Challenge 3: Maintaining Membrane Protein Stability During Extraction

  • Solution: Use gentle detergents for extraction (DDM, LDAO, CHAPS)

  • Solution: Include glycerol (10-15%) in all buffers to stabilize membrane proteins

  • Solution: Add lipids (0.01-0.05% phosphatidylglycerol) to maintain native-like environment

  • Solution: Maintain low temperature (4°C) throughout purification process

Challenge 4: Loss of Activity During Purification

  • Solution: Include protease inhibitors in all buffers

  • Solution: Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Solution: Minimize purification steps and process time

  • Solution: Include substrate lipids (phosphatidylglycerol) at low concentrations in buffers

Challenge 5: Protein Aggregation During Storage

  • Solution: Lyophilize with 6% trehalose as a stabilizer

  • Solution: Store at -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Solution: For reconstituted protein, add 5-50% glycerol and store at -20°C/-80°C

  • Solution: Consider flash-freezing in liquid nitrogen before storage

Challenge 6: Assessing Enzyme Activity

  • Solution: Verify protein folding by circular dichroism before activity assays

  • Solution: Reconstitute enzyme in liposomes to provide native-like membrane environment

  • Solution: Optimize buffer conditions (pH, ionic strength, divalent cations)

  • Solution: Develop sensitive detection methods for cardiolipin formation

Optimized Purification Protocol:

  • Express His-tagged cardiolipin synthase in E. coli at reduced temperature (20°C)

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitors

  • Lyse cells using mild sonication or French press

  • Solubilize membrane fraction with 1% DDM for 1 hour at 4°C

  • Clarify by ultracentrifugation (100,000×g, 1 hour)

  • Purify using Ni-NTA affinity chromatography with detergent-containing buffers

  • Elute with imidazole gradient (50-250 mM)

  • Dialyze to remove imidazole

  • Concentrate and further purify by size exclusion chromatography

  • Stabilize final preparation with 6% trehalose and lyophilize or add glycerol (final 50%) and flash-freeze

How can researchers accurately differentiate between the activities of ClsA, ClsB, and ClsC in experimental systems?

Accurately differentiating between the activities of ClsA, ClsB, and ClsC in experimental systems requires sophisticated approaches that exploit their distinct biochemical properties, substrate preferences, and expression patterns. The following methodological framework enables precise discrimination between these cardiolipin synthases:

1. Genetic Approaches:

  • Generate single, double, and triple knockout mutants (ΔclsA, ΔclsB, ΔclsC, ΔclsA ΔclsB, etc.)

  • Complement with plasmid-expressed individual cls genes under controlled promoters

  • Use inducible expression systems to control the timing and level of each synthase

  • Apply CRISPR-Cas9 for precise genome editing to introduce tagged versions of each gene

2. Growth Phase-Specific Analysis:

  • Analyze exponential phase cultures to primarily detect ClsA activity

  • Examine stationary phase cultures to observe combined ClsA and ClsC activities

  • Monitor the transition between growth phases to detect temporal changes in enzyme activities

  • Culture cells under stress conditions to identify condition-specific activation patterns

3. Substrate Preference Assays:

  • Develop in vitro assays using purified enzymes with different potential substrates:

    • ClsA/ClsB: Two phosphatidylglycerol molecules

    • ClsC: Phosphatidylglycerol and phosphatidylethanolamine

  • Measure relative reaction rates with different substrate combinations

  • Use synthetic substrates with modified head groups to enhance enzyme discrimination

  • Apply mass spectrometry to identify specific molecular species produced by each enzyme

4. Biochemical Discrimination Methods:

  • Measure enzyme activity across different pH ranges to identify optimal conditions for each synthase

  • Determine temperature sensitivity profiles for each enzyme

  • Test inhibitor sensitivity patterns unique to each synthase

  • Analyze divalent cation requirements and preferences (Mg2+, Mn2+, Ca2+)

5. Enzyme-Specific Detection:

  • Develop antibodies specific to each Cls protein for western blotting and immunoprecipitation

  • Create epitope-tagged versions of each enzyme for specific detection

  • Employ activity-based protein profiling with enzyme-specific probes

  • Use proximity ligation assays to detect enzyme-substrate interactions

6. Product Analysis Techniques:

  • Apply thin-layer chromatography with optimized solvent systems for product separation

  • Implement mass spectrometry to analyze the molecular species of cardiolipin produced by each enzyme

  • Use 31P-NMR spectroscopy to monitor phospholipid conversion patterns

  • Develop enzyme-specific fluorescent reporters that respond to particular product formations

7. Data Analysis Framework:

  • Establish quantitative parameters for each enzyme's activity:

ParameterClsAClsBClsC
Primary substratesTwo PG moleculesTwo PG moleculesPG and PE
Growth phase activityExponential and stationaryLimited under standard conditionsPrimarily stationary phase
Contribution to total CL~90-100% in exponential phaseMinimal under standard conditions~10% in stationary phase
Phenotype of mutantNo detectable CL in exponential phaseNo significant change in CL levelsReduced CL in stationary phase
Complementation effectRestores CL to wild-type levelsMinimal effect on total CLRestores stationary phase CL in ΔclsA background

By systematically applying these approaches, researchers can confidently distinguish between the activities of the three cardiolipin synthases and accurately attribute specific cellular phenotypes to each enzyme.

What emerging technologies might transform our understanding of cardiolipin synthase structure-function relationships?

Emerging technologies across multiple scientific disciplines are poised to revolutionize our understanding of cardiolipin synthase structure-function relationships. These innovative approaches will enable unprecedented insights into enzyme mechanics, regulation, and potential therapeutic targeting:

1. Advanced Structural Biology Techniques:

  • Cryo-Electron Microscopy (cryo-EM): Enables visualization of membrane-embedded cardiolipin synthase at near-atomic resolution without crystallization, capturing multiple conformational states during the catalytic cycle

  • Microcrystal Electron Diffraction (MicroED): Allows structure determination from nanocrystals of membrane proteins that resist traditional crystallization

  • Serial Femtosecond Crystallography: Uses X-ray free-electron lasers (XFELs) to capture "diffraction before destruction" snapshots of cardiolipin synthase during catalysis

  • Integrative Structural Biology: Combines multiple techniques (NMR, SAXS, mass spectrometry, computational modeling) to generate comprehensive structural models

2. Single-Molecule Technologies:

  • Single-Molecule FRET: Monitors conformational changes in cardiolipin synthase during substrate binding and catalysis in real-time

  • Optical Tweezers: Measures force generation and mechanical properties during enzyme-substrate interactions

  • Nanopore Technology: Analyzes individual enzyme molecules as they translocate through nanopores, revealing heterogeneity in enzyme populations

  • Super-Resolution Microscopy: Visualizes cardiolipin synthase distribution and dynamics in bacterial membranes with nanometer precision

3. Computational and AI-Driven Approaches:

  • AlphaFold/RoseTTAFold: Predicts accurate membrane protein structures, including cardiolipin synthase variants

  • Molecular Dynamics Simulations: Models enzyme-membrane interactions across biologically relevant timescales

  • Machine Learning Algorithms: Identifies patterns in sequence-structure-function relationships across diverse bacterial species

  • Quantum Mechanics/Molecular Mechanics (QM/MM): Provides detailed insights into the catalytic mechanism at the electronic level

4. Synthetic Biology and Protein Engineering:

  • Directed Evolution: Creates enzyme variants with enhanced activity or altered specificity

  • Non-canonical Amino Acid Incorporation: Introduces novel chemical functionalities for mechanistic studies

  • Optogenetic Control: Develops light-activated cardiolipin synthase variants for precise temporal control

  • Minimal Synthetic Cells: Tests cardiolipin synthase function in defined membrane environments

5. Advanced Genomics and Systems Biology:

  • Single-Cell Transcriptomics: Reveals expression heterogeneity of cls genes in bacterial populations

  • CRISPRi/CRISPRa Screens: Identifies genetic interactions and regulatory networks controlling cardiolipin synthesis

  • Metabolic Flux Analysis: Tracks the flow of phospholipid precursors through biosynthetic pathways under different conditions

  • Multi-omics Integration: Combines transcriptomics, proteomics, and lipidomics data to build comprehensive models of cardiolipin metabolism

6. Innovative Imaging Technologies:

  • Correlative Light and Electron Microscopy (CLEM): Links functional data from fluorescence microscopy with structural information from electron microscopy

  • Mass Spectrometry Imaging: Maps the spatial distribution of cardiolipin and related phospholipids within bacterial cells

  • Live-Cell Tracking: Monitors cardiolipin synthase localization and activity in real-time within living bacteria

  • Atomic Force Microscopy-Infrared Spectroscopy (AFM-IR): Provides nanoscale chemical characterization of membrane domains

These transformative technologies will collectively enable researchers to connect atomic-level structural details with cellular-level functions, revealing how cardiolipin synthases operate within the complex environment of bacterial membranes and how their activities contribute to bacterial physiology and pathogenesis.

What are the critical unanswered questions about cardiolipin synthase that could drive significant advances in microbial physiology?

Several critical unanswered questions about cardiolipin synthase remain at the frontier of microbial physiology research. Addressing these knowledge gaps could drive significant scientific advances and potentially lead to new antimicrobial strategies:

Regulatory Mechanisms and Environmental Responsiveness

  • How is cardiolipin synthase expression and activity regulated in response to environmental stresses?

  • What transcriptional and post-translational mechanisms control the balance between different Cls enzymes during various growth phases ?

  • Do bacterial two-component systems directly influence cardiolipin synthesis during host infection?

  • How do bacteria sense and respond to changes in membrane cardiolipin levels?

Structural Determinants of Substrate Specificity

  • What structural features determine the substrate preferences of ClsA, ClsB, and ClsC ?

  • How do these enzymes recognize and position their phospholipid substrates for catalysis?

  • What is the atomic-level mechanism of the condensation reaction?

  • Can cardiolipin synthases utilize substrates with non-native fatty acid compositions?

Membrane Organization and Protein-Lipid Interactions

  • How does cardiolipin organize into domains within bacterial membranes?

  • What specific protein-cardiolipin interactions mediate proper localization of virulence factors like IcsA ?

  • Does cardiolipin create specialized membrane microenvironments for protein function?

  • How does the absence of cardiolipin affect membrane biophysical properties and bacterial cell division?

Transport and Flip-Flop Mechanisms

  • What is the molecular mechanism by which PbgA/YejM transports cardiolipin from the inner to the outer membrane ?

  • Are there additional transport proteins involved in cardiolipin trafficking?

  • How is cardiolipin asymmetry maintained between membrane leaflets?

  • What mechanisms control the distribution of newly synthesized cardiolipin?

Evolutionary Aspects and Host-Pathogen Interactions

  • Why do some eukaryotic organisms possess bacterial-type cardiolipin synthases ?

  • How has cardiolipin synthase evolved in different bacterial lineages?

  • Does host immunity specifically target bacterial cardiolipin or its synthesis?

  • How do intracellular pathogens adapt their cardiolipin composition during infection?

Metabolic Integration and Phospholipid Homeostasis

  • How is cardiolipin synthesis coordinated with other phospholipid biosynthetic pathways?

  • What metabolic signals regulate the balance between phosphatidylglycerol and cardiolipin ?

  • How do bacteria maintain phospholipid homeostasis when cardiolipin synthesis is disrupted?

  • What are the consequences of cardiolipin depletion on other cellular processes?

Host Responses to Bacterial Cardiolipin

  • Do host cells recognize bacterial cardiolipin as a pathogen-associated molecular pattern?

  • Can bacterial cardiolipin interact with host mitochondrial membranes during infection?

  • How does bacterial cardiolipin influence host immune responses?

  • Could bacterial cardiolipin contribute to inflammatory pathologies during infection?

Therapeutic Targeting Potential

  • Can cardiolipin synthase inhibitors be developed as novel antimicrobials?

  • What structural features could be exploited for selective targeting of bacterial versus eukaryotic enzymes?

  • Would targeting cardiolipin synthesis create synergies with existing antibiotics?

  • How might bacteria develop resistance to cardiolipin synthase inhibitors?

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, biophysics, and infection biology. The answers will not only advance fundamental understanding of bacterial physiology but could also open new avenues for antimicrobial development targeting this essential phospholipid biosynthetic pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.