Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Cobalamin Synthase (cobS) Overview

Cobalamin synthase (cobS) is a critical enzyme in the biosynthesis pathway of cobalamin (vitamin B12), catalyzing the final steps of adenosylcobalamin formation. In Shigella boydii, cobS is encoded on the chromosome and shares structural homology with orthologs in Escherichia coli and Salmonella .

Key Features of cobS:

  • Function: Transfers the adenosyl group from ATP to cobalamin .

  • Structure: Typically consists of 247 amino acids (≈37 kDa) with conserved domains for nucleotide binding .

  • Localization: Membrane-associated due to hydrophobic regions in its sequence .

Recombinant cobS in Shigella boydii

While serotype 4-specific data are absent, recombinant cobS production for other S. boydii serotypes follows standardized protocols:

PropertyDetailsSource SerotypeReference
Expression HostE. coli BL21 (DE3)18
TagN-terminal His-tag for purification18
Purity>90% by SDS-PAGE18
StorageTris buffer with 50% glycerol, -80°C18
ApplicationsELISA, enzymatic assays, structural studies18

Notes:

  • Serotype-specific variations in cobS amino acid sequences may influence antigenicity or enzymatic activity .

  • No cross-reactivity data exist between serotype 4 and other serotypes.

Genomic Context of cobS in Shigella boydii

Comparative genomic studies reveal:

  • Phylogenetic Diversity: S. boydii cobS clusters into three clades with distinct gene content, indicating adaptive divergence .

  • Synteny: The cobS locus is conserved between S. boydii and Salmonella Newport, flanked by genes for cobalamin transport (btuR) and metabolism (cobT) .

  • Antigenic Potential: CobS is not directly implicated in virulence but may serve as a diagnostic marker due to species-specific epitopes .

Research Applications

Recombinant cobS proteins are used in:

  1. Vaccine Development: CobS homologs have been tested as subunit vaccine components in Shigella models (e.g., fused with Salmonella T2544 protein) .

  2. Diagnostics: Phage-based assays targeting S. boydii serotypes utilize proteins like cobS for specificity .

  3. Antimicrobial Studies: CobS inhibitors could disrupt cobalamin metabolism in pathogenic Enterobacteriaceae .

Gaps in Serotype 4-Specific Data

No publications in the provided corpus address S. boydii serotype 4 cobS. Critical unknowns include:

  • Sequence divergence compared to serotype 18 cobS.

  • Structural or functional variations impacting recombinant protein utility.

  • Cross-protective immunity in animal models.

Recommendations for Future Research

  • Comparative Genomics: Analyze serotype 4 cobS against existing serotypes (e.g., 13, 18) to identify unique motifs .

  • Structural Biology: Resolve cryo-EM structures to map catalytic sites and design inhibitors.

  • Serotyping Assays: Develop monoclonal antibodies against recombinant cobS for serotype differentiation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format during the ordering process, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with regular blue ice packs. For dry ice shipping, please contact us in advance for arrangements and additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
cobS; SBO_1211; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILALLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from Shigella boydii serotype 4 catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: sbo:SBO_1211

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii serotype 4 and how is it genetically characterized?

Shigella boydii serotype 4 is one of the 20 recognized serotypes within the S. boydii species, which belongs to the family Enterobacterales. Genetic characterization involves analysis of the O-antigen gene cluster located between the galF and gnd genes. For S. boydii serotype 4, this region spans approximately 10,551 bp and contains 10 genes responsible for O-antigen synthesis . This serotype shares its O-antigen structure with Escherichia coli O53, indicating evolutionary relationships between these bacterial strains .

The complete genetic characterization typically includes:

  • Sequencing of the O-antigen gene cluster

  • Identification of sugar transferase genes (including wbdS, wbdG, wbdE, and wbdF)

  • Analysis of O-antigen processing genes (wzx and wzy)

  • Determination of nucleotide sugar biosynthesis genes

When studying S. boydii serotype 4, researchers should note that unlike some other serotypes (such as serotype 6 and 9), serotype 4 does not contain atypical genetic features like insertion sequences or inversely oriented genes .

What is Cobalamin synthase (cobS) and what role does it play in bacterial metabolism?

Cobalamin synthase (cobS) is a key enzyme in the vitamin B12 (cobalamin) biosynthesis pathway. This enzyme catalyzes one of the approximately 30 enzymatic steps required for complete cobalamin synthesis . Specifically, cobS functions in the later stages of cobalamin biosynthesis.

The enzymatic function of cobS involves:

  • Participation in the assembly of the corrin ring structure

  • Contribution to the adenosylation process of the vitamin B12 molecule

  • Facilitation of cobalt incorporation into the developing cobalamin structure

In bacterial metabolism, functional cobS is essential for:

  • Methionine synthesis via the MetH-dependent pathway

  • Various methyltransferase reactions

  • Maintaining proper enzymatic reactions dependent on adenosylated cobamides

The cobS gene typically encodes a membrane-associated protein. For example, in S. boydii serotype 18, the cobS product consists of 247 amino acids with multiple transmembrane domains, suggesting its localization to the cell membrane .

How do I correctly identify and verify Shigella boydii serotype 4 isolates?

Proper identification and verification of S. boydii serotype 4 isolates require multiple complementary approaches:

Traditional Biochemical and Serological Methods:

  • Gram staining (appears as Gram-negative rods, 1-3μm in length, 0.7-1.0μm in diameter)

  • Biochemical tests showing negative motility, positive indole production (variable), and negative lysine decarboxylase activity

  • Serological identification using slide agglutination with polyvalent somatic (O) antigen grouping sera specific for S. boydii, followed by monovalent antisera for serotype 4 identification

Molecular Identification Methods:

  • PCR amplification of the O-antigen gene cluster using primers based on the galF and gnd genes

  • Detection of invasion-associated genes like ipaH

  • Whole genome sequencing (WGS) for definitive identification and characterization

Bacteriophage-Based Identification:
While not specifically developed for serotype 4, phage-based diagnostics have been successfully used for other serotypes. Similar approaches could be adapted for serotype 4 identification .

Identification MethodAdvantagesLimitations
Biochemical testingAccessible, established protocolsNot serotype-specific
Serological typingGold standard for serotypingRequires specific antisera
PCR-based detectionHigh sensitivity and specificityRequires specific primers and equipment
Whole genome sequencingComprehensive genetic characterizationHigher cost and computational requirements
Phage-based diagnosticsRapid and potentially low-costStill under development for most serotypes

What are the optimal methods for expressing recombinant Shigella boydii serotype 4 cobS?

Optimal expression of recombinant S. boydii serotype 4 cobS requires careful consideration of expression systems, growth conditions, and purification strategies:

Expression System Selection:

  • E. coli-based systems: BL21(DE3) or derivatives are commonly used for expression of Shigella proteins due to genetic similarity

  • Expression vectors: pET series vectors with T7 promoter systems offer high-level inducible expression

  • Fusion tags: Based on similar recombinant protein studies, a His-tag approach is effective for cobS purification

Optimized Growth and Induction Conditions:

  • Media: Rich media like APS Super Broth supplemented with 0.4% glucose and appropriate antibiotics

  • Temperature: Growth at 37°C until optimal OD is reached, followed by induction at lower temperatures (16-25°C) to enhance protein solubility

  • Induction: IPTG concentration typically between 0.1-1.0 mM, with lower concentrations sometimes yielding better soluble protein

  • Duration: Extended expression periods (overnight) at lower temperatures often increase yield of functional protein

Considerations for Membrane Protein Expression:
Since cobS likely contains membrane-associated domains , special considerations include:

  • Use of specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Addition of detergents during extraction and purification steps

  • Evaluation of different solubilization strategies with appropriate detergents

For optimal expression, monitor dissolved oxygen concentration (set point between 20-40%) and control via agitation cascade (200-500 rpm) as used for other recombinant Shigella proteins .

What purification strategies yield the highest purity of recombinant cobS?

Purification of recombinant cobS requires a multi-step approach to achieve high purity while maintaining functional integrity:

Initial Extraction and Solubilization:

  • Cell lysis using methods compatible with membrane proteins (sonication, French press, or detergent-based lysis)

  • Selection of appropriate buffers containing 50% glycerol to maintain stability, as shown effective for cobS from serotype 18

  • Solubilization using mild detergents (DDM, CHAPS, or Triton X-100) to extract membrane-associated proteins

Chromatography Sequence:

  • Immobilized Metal Affinity Chromatography (IMAC): Using Ni-NTA or similar resin for initial capture of His-tagged cobS

  • Ion Exchange Chromatography: To separate cobS from proteins with similar affinity for IMAC

  • Size Exclusion Chromatography: Final polishing step to achieve highest purity

Optimized Storage Conditions:

  • Storage in Tris-based buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles by preparing working aliquots

  • Store working aliquots at 4°C for up to one week and long-term storage at -20°C or -80°C

Purity Assessment:

  • SDS-PAGE with Coomassie staining (target >95% purity)

  • Western blot analysis using anti-His antibodies or custom anti-cobS antibodies

  • Mass spectrometry for definitive identity confirmation

How does Shigella boydii serotype 4 cobS compare with cobS from other Shigella serotypes and related bacteria?

Comparative analysis of cobS across Shigella serotypes and related bacteria reveals both conserved features and important differences:

Sequence Homology Analysis:
The cobS gene is part of the conserved cobalamin biosynthesis pathway, but exhibits variations across different Shigella serotypes. While specific data for serotype 4 cobS is limited, analysis of other serotypes provides valuable insights:

OrganismAmino Acid Identity to S. boydii serotype 4 cobS*Key Differences
S. boydii serotype 18~90-95% (estimated)Differences primarily in membrane-spanning regions
E. coli~90-95% (estimated)High conservation reflecting close evolutionary relationship
Pseudomonas denitrificans~50-60% (estimated)Significant differences reflecting divergent evolution while maintaining function
Propionibacterium shermanii~40-50% (estimated)Major differences due to different cobalamin synthesis pathways

*Estimated based on typical conservation patterns in Shigella and related organisms

Functional Conservation:
Despite sequence variations, the core catalytic function of cobS is conserved across species, which is reflected in the ability of cobS from different sources to complement growth defects in cobS mutants.

Gene Organization and Regulation:
The genetic context of cobS varies among different organisms:

  • In most Shigella and E. coli strains, cobS is part of a conserved operon structure

  • Expression regulation may differ between serotypes based on their environmental adaptations

  • The presence of insertion sequences and genomic rearrangements in some serotypes might affect cobS expression

Evolutionary Implications:
The high conservation of cobS across Shigella serotypes suggests its essential role in bacterial survival and metabolism. The differences observed can provide insights into the adaptive evolution of different serotypes.

What structural features of Shigella boydii serotype 4 cobS are crucial for its function?

The structure-function relationship in S. boydii serotype 4 cobS reveals several critical features essential for its enzymatic activity:

Key Structural Domains:
Based on analysis of cobS proteins from S. boydii serotype 18 and related organisms :

  • Transmembrane Domains: The protein contains multiple transmembrane helices (evident from the sequence MSKLFW...VFLLALL) that anchor it to the cell membrane

  • Substrate Binding Pocket: Conserved residues involved in binding the corrin ring structure

  • Metal Coordination Site: Specific residues responsible for coordinating cobalt ions

  • ATP-Binding Region: Domains that bind ATP required for the energetically unfavorable reactions

Critical Functional Residues:
Based on sequence analysis and comparative studies with other cobS proteins:

  • Conserved histidine residues likely involved in metal coordination

  • Arginine and lysine residues important for substrate binding and catalysis

  • Transmembrane glycine-rich regions that provide structural flexibility

Structural Modifications Affecting Function:

  • Point mutations in the metal coordination site can completely abolish enzymatic activity

  • Alterations to the membrane-spanning domains affect protein localization and stability

  • Changes in the substrate binding pocket may alter substrate specificity

Predicted Structural Model:
While a crystal structure for S. boydii serotype 4 cobS is not available, homology modeling based on related proteins suggests a structure with:

  • Multiple membrane-spanning α-helices

  • Catalytic domain positioned to interface with both cytoplasmic and membrane environments

  • Conserved binding pockets for cobalamin precursors and cofactors

How can recombinant Shigella boydii serotype 4 cobS be utilized in diagnostic tool development?

Recombinant S. boydii serotype 4 cobS offers several applications for developing advanced diagnostic tools:

Antibody-Based Diagnostic Approaches:

  • Development of Specific Antibodies: Purified recombinant cobS can be used to raise polyclonal or monoclonal antibodies specific to S. boydii serotype 4

  • ELISA Development: These antibodies can be employed in enzyme-linked immunosorbent assays for detection of S. boydii serotype 4 in clinical samples

  • Immunochromatographic Tests: Development of rapid lateral flow assays for point-of-care diagnostics

PCR-Based Detection Systems:

  • Primer Design: Based on unique sequences in the serotype 4 cobS gene

  • Multiplex PCR: Combined detection of cobS and other serotype-specific markers

  • Real-time PCR: Quantitative detection using fluorescent probes targeting cobS

Phage-Based Diagnostic Tools:
Drawing from successful development of phage MK-13 for S. boydii type 1 diagnosis , similar approaches could be applied for serotype 4:

  • Isolation of serotype 4-specific bacteriophages

  • Development of phage-based detection systems

  • Implementation of rapid lysis-based diagnostic assays

Advantages of cobS-Based Diagnostics:

  • High specificity when combined with O-antigen detection

  • Potential for distinguishing between closely related serotypes

  • Applicable in resource-limited settings with appropriate technology adaptation

The development of these diagnostic tools would significantly enhance the specific identification of S. boydii serotype 4 in clinical and environmental samples, improving surveillance and epidemiological studies.

What role does cobS play in bacterial virulence and how does this impact vaccine development strategies?

While cobS is primarily involved in vitamin B12 biosynthesis rather than direct virulence, its role in bacterial metabolism has significant implications for virulence and vaccine development:

Metabolic Contributions to Virulence:

  • Nutritional Advantage: Functional cobS enables S. boydii to synthesize vitamin B12, potentially providing a growth advantage in nutrient-limited host environments

  • Metabolic Adaptation: The ability to synthesize cobalamin may contribute to bacterial survival during infection

  • Persistence Mechanisms: Proper metabolism supported by cobS-dependent pathways may contribute to bacterial persistence, as observed in other Shigella serotypes

Implications for Vaccine Development:
The connection between cobS and bacterial metabolism suggests several vaccine development strategies:

  • Metabolic Attenuation Approach:

    • Creating attenuated live vaccine strains with modified cobS function

    • Developing strains that retain immunogenicity but have limited capacity for persistence

  • Combination Antigen Vaccines:

    • Including cobS alongside traditional virulence antigens (like Ipa proteins) in subunit vaccines

    • Development of an "Invaplex AR" type approach that incorporates both O-antigen and protein components

  • Cross-Protective Vaccine Potential:

    • The relatively conserved nature of cobS across Shigella serotypes suggests potential for cross-protection

    • Identification of conserved epitopes that could provide broader protection against multiple serotypes

Current Vaccine Development Context:
Contemporary Shigella vaccine development focuses primarily on:

  • O-antigen specificity (serotype-specific protection)

  • Invasion plasmid antigens (IpaB, IpaC, etc.)

  • Attenuated live vaccines with modified virulence genes

While cobS is not currently a primary target in Shigella vaccine development, its role in bacterial metabolism and potential contribution to persistence make it a candidate for consideration in metabolically attenuated vaccine strategies.

How can researchers troubleshoot common issues with recombinant cobS activity?

Researchers working with recombinant cobS frequently encounter several challenges that can affect enzyme activity. The following troubleshooting guide addresses common issues and their solutions:

Issue 1: Low or No Detectable Activity

Potential CauseDiagnostic ApproachSolution
Improper protein foldingAnalysis by circular dichroism- Express at lower temperature
- Use molecular chaperones
- Try different solubilization methods
Inactive conformationSize exclusion chromatography to check oligomeric state- Optimize buffer conditions
- Add stabilizing agents (glycerol, reducing agents)
Missing cofactorsSystematic cofactor addition experiments- Supplement reaction with ATP, GTP, Mg2+, Co2+
- Ensure reducing environment with DTT or β-mercaptoethanol
Degraded substrateHPLC analysis of substrate quality- Prepare fresh substrate
- Store properly (avoid light, oxidation)
- Verify substrate structure by MS

Issue 2: Poor Reproducibility

Potential CauseDiagnostic ApproachSolution
Variable enzyme preparationsSDS-PAGE and activity comparison of multiple preparations- Standardize purification protocol
- Prepare larger batches and aliquot
- Include quality control checkpoints
Unstable reaction componentsTime-course stability analysis- Prepare fresh components before each assay
- Optimize storage conditions
- Consider stabilizing additives
Environmental variationsControlled condition experiments- Maintain consistent temperature- Control oxygen exposure- Use temperature-controlled reaction chambers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.