Recombinant Shigella boydii serotype 4 Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
dsbB; SBO_1887; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
dsbB
Target Protein Sequence
MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV PQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVMISQPFKAKKRDLFGR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Functions by oxidizing the DsbA protein.
Database Links

KEGG: sbo:SBO_1887

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii and how is it classified taxonomically?

Shigella boydii is a Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacteria first discovered in 1897. It belongs to the genus Shigella, which causes disease primarily in primates such as humans and gorillas, but not in other mammals . Shigella is closely related to Escherichia coli and represents one of the leading bacterial causes of diarrhea worldwide, particularly affecting children in African and South Asian regions . The Shigella genus is classified into four species (also called groups or subgroups): S. dysenteriae (15 serotypes), S. flexneri (15 serotypes and subserotypes), S. boydii (19 serotypes), and S. sonnei (1 serotype) . S. boydii serotype 4 is one of the 19 serotypes within the S. boydii species, with serotypes defined by conformational epitopes of their O polysaccharide antigens .

What is the function of Disulfide Bond Formation Protein B (dsbB) in bacterial systems?

Disulfide Bond Formation Protein B (dsbB) is part of the Dsb (Disulfide bond) protein family that includes DsbA, DsbB, DsbC, and DsbD. These proteins play crucial roles in catalyzing the formation and isomerization of protein disulfide bonds in the bacterial periplasm . Specifically, dsbB functions in the oxidative pathway of disulfide bond formation. After DsbA donates its disulfide bond to substrate proteins, DsbB reoxidizes DsbA, thereby completing the electron transfer cycle. This oxidation-reduction cycle is essential for proper protein folding and stability of numerous periplasmic and secreted proteins that contain disulfide bonds . In S. boydii, as in other Gram-negative bacteria, dsbB is integral to the structural integrity and functionality of many proteins involved in pathogenesis, virulence, and survival.

Why would researchers specifically study recombinant S. boydii serotype 4 dsbB?

Researchers study recombinant S. boydii serotype 4 dsbB for several compelling scientific reasons. First, understanding the molecular mechanisms of protein folding in pathogenic bacteria provides insights into bacterial survival and virulence strategies. Second, the Dsb system represents a potential antimicrobial target, as disrupting proper protein folding could compromise bacterial viability or virulence . Third, S. boydii is a significant human pathogen that causes diarrheal disease, making its virulence factors and essential proteins important research subjects . Finally, the dsbB protein could serve as a biotechnological tool for enhancing production of recombinant proteins with disulfide bonds in bacterial expression systems, as demonstrated by studies showing that Dsb protein overexpression can markedly increase periplasmic production of recombinant proteins .

What expression systems are suitable for producing recombinant S. boydii dsbB?

Based on established protocols for similar proteins, recombinant S. boydii dsbB can be expressed using several systems, most notably E. coli, which is closely related to Shigella genetically . Other expression systems include yeast, baculovirus, or mammalian cell culture systems . The selection of an expression system depends on research goals, required protein yields, and downstream applications. For structural and functional studies, E. coli is often preferred due to its simplicity, cost-effectiveness, and genetic tractability. When producing the protein for experimental purposes, appropriate vector selection, optimal codon usage, and addition of purification tags (such as His-tag) should be considered to ensure efficient expression and purification. The expression conditions need careful optimization, including induction parameters, temperature, and media composition to maximize yield while maintaining proper folding.

How does the structure and function of S. boydii dsbB compare to its homologs in other enteric bacteria?

S. boydii dsbB shares significant structural and functional homology with dsbB proteins from other enteric bacteria, particularly E. coli, due to their close evolutionary relationship . The dsbB protein typically contains four transmembrane segments with two periplasmic loops harboring conserved cysteine residues essential for its redox function. Cross-species comparative analysis reveals high conservation in the redox-active sites and membrane topology, but potential variation in regulatory domains that may reflect species-specific adaptations to different host environments or pathogenic strategies. These structural variations may influence substrate specificity or catalytic efficiency, potentially impacting virulence mechanisms. Researchers investigating these differences would typically employ techniques such as site-directed mutagenesis, protein modeling, and complementation studies to characterize the functional significance of species-specific variations, which could ultimately inform targeted therapeutic strategies against Shigella infections.

What is the impact of dsbB overexpression on S. boydii pathogenicity and host immune response?

Overexpression of dsbB in S. boydii likely enhances the formation of correctly folded virulence factors containing disulfide bonds, potentially amplifying bacterial pathogenicity. This hypothesis is supported by research demonstrating that Dsb proteins play crucial roles in the proper folding of virulence determinants in related bacterial species . The enhanced stability and function of virulence factors may modify host-pathogen interactions in multiple ways, including increased bacterial adhesion, invasion efficiency, and resistance to host defense mechanisms. From an immunological perspective, alterations in surface protein conformation resulting from dsbB overexpression might modify epitope presentation, potentially affecting antigen recognition by the host immune system. This could alter both innate immune responses (through pattern recognition receptor interactions) and adaptive immunity (through modified T-cell and B-cell responses). Experimental approaches to investigate these effects would include in vitro infection models, cytokine profiling, and in vivo virulence studies comparing wild-type and dsbB-overexpressing strains.

How can site-directed mutagenesis of S. boydii dsbB inform protein engineering strategies?

Site-directed mutagenesis of S. boydii dsbB represents a powerful approach for understanding structure-function relationships and developing protein engineering strategies. By systematically altering key amino acid residues, researchers can identify critical determinants of catalytic activity, substrate specificity, and redox potential. Research on related Dsb proteins has demonstrated that mutations in the active site cysteines completely abolish activity, while mutations in surrounding residues can modulate catalytic efficiency . These insights enable rational design of dsbB variants with enhanced or modified activities for biotechnological applications. For instance, engineered dsbB variants could potentially improve production yields of disulfide-rich recombinant proteins in bacterial expression systems, as suggested by studies showing that overexpression of Dsb proteins significantly enhances periplasmic protein production . Additionally, mutagenesis studies can identify inhibitor-binding sites, informing development of antimicrobial compounds targeting the Dsb system.

What mechanisms regulate dsbB expression in S. boydii under various environmental conditions?

The regulation of dsbB expression in S. boydii involves complex transcriptional, post-transcriptional, and post-translational mechanisms that respond to various environmental stimuli encountered during infection. Oxidative stress likely plays a significant regulatory role, as dsbB functions within redox pathways essential for maintaining protein homeostasis under changing oxidation conditions. pH fluctuations, as experienced during gastrointestinal transit, may also modulate dsbB expression through stress-responsive transcription factors. Nutrient availability, particularly iron concentration, could influence dsbB expression as part of broader virulence regulation networks. These regulatory mechanisms can be investigated through transcriptomic and proteomic analyses of S. boydii cultured under various environmental conditions simulating host microenvironments. Promoter-reporter fusion studies would allow visualization of expression dynamics in real-time, while chromatin immunoprecipitation techniques could identify transcription factors directly regulating dsbB. Understanding these regulatory mechanisms has implications for both basic bacterial physiology and for identifying intervention points to disrupt S. boydii virulence during infection.

What are the optimal conditions for expressing and purifying recombinant S. boydii dsbB?

Expression and purification of recombinant S. boydii dsbB requires careful optimization due to its membrane-associated nature and redox-active properties. Based on established protocols for similar proteins, the following methodological approach is recommended:

Expression System Selection:
E. coli BL21(DE3) or C41(DE3) strains are particularly suitable for membrane protein expression . The latter is specifically engineered for toxic membrane proteins.

Vector and Construct Design:

  • Insert a hexahistidine or other affinity tag (preferably at the C-terminus to avoid interference with membrane insertion)

  • Include a protease cleavage site for tag removal if needed for functional studies

  • Consider codon optimization for E. coli if expression levels are low

Expression Conditions:
The following parameters should be systematically optimized:

ParameterRecommended RangeNotes
Induction temperature16-30°CLower temperatures (16-20°C) often improve membrane protein folding
IPTG concentration0.1-0.5 mMLower concentrations may reduce aggregation
Induction time4-18 hoursLonger at lower temperatures
Media compositionLB or TB with supplementsAddition of 0.2% glucose can reduce basal expression

Membrane Protein Extraction:
Gentle extraction with mild detergents is crucial. A sequential extraction approach is recommended:

  • Cell disruption via sonication or French press in buffer containing protease inhibitors

  • Membrane fraction isolation via ultracentrifugation (100,000 × g for 1 hour)

  • Membrane solubilization using detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG)

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates and contaminants

  • Maintenance of reducing agents (typically 1-5 mM DTT) in all buffers to preserve cysteine redox state

This optimized protocol should yield pure, functional dsbB protein suitable for structural and functional studies .

How can researchers assess the functional activity of recombinant S. boydii dsbB in vitro?

Assessing the functional activity of recombinant S. boydii dsbB requires methods that measure its ability to catalyze disulfide bond formation. The following complementary approaches provide comprehensive functional characterization:

Enzymatic Activity Assays:

  • DsbA Reoxidation Assay: This primary functional test measures dsbB's ability to reoxidize reduced DsbA using:

    • Purified reduced DsbA as substrate

    • Ubiquinone as electron acceptor

    • Monitoring change in fluorescence or absorbance as DsbA transitions from reduced to oxidized state

  • Coupled Assay with Model Substrates: Measures complete disulfide bond formation pathway:

    • System contains reduced DsbA, dsbB, ubiquinone, and a model substrate protein with disulfide bonds

    • Rate of substrate oxidation measured by AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid) alkylation and SDS-PAGE mobility shift

Biophysical Characterization:

  • Redox Potential Measurement: Using redox buffers of defined potential and monitoring protein oxidation state

  • Thermal Stability Analysis: Differential scanning fluorimetry to assess protein stability under various conditions

  • Membrane Association Studies: Assessing proper insertion into lipid bilayers using liposome floatation assays

Complementation Studies:

Functional activity can be assessed in vivo through complementation of dsbB-deficient bacterial strains:

  • Transform dsbB-knockout E. coli with plasmid expressing S. boydii dsbB

  • Measure restoration of phenotypes dependent on disulfide bond formation, such as:

    • Motility (flagellar proteins require disulfide bonds)

    • Alkaline phosphatase activity (contains disulfide bonds)

    • Resistance to reducing agents like DTT

Model Protein Folding Enhancement:

Test the ability of recombinant dsbB to enhance correct folding of a reporter protein:

  • Co-express dsbB with a difficult-to-fold disulfide-containing protein like horseradish peroxidase (HRP)

  • Measure increase in soluble, active protein as evidence of functional dsbB activity

These methodologies provide multiple lines of evidence for dsbB functionality, ensuring reliable characterization of wild-type protein and engineered variants.

What are the recommended approaches for studying protein-protein interactions involving S. boydii dsbB?

Investigating protein-protein interactions involving S. boydii dsbB requires specialized techniques that accommodate its membrane-associated nature and redox functionality. The following methodological approaches are recommended:

In Vitro Interaction Studies:

  • Co-Immunoprecipitation with Membrane Solubilization:

    • Solubilize membrane fractions using mild detergents (DDM, CHAPS)

    • Perform pulldown with anti-dsbB antibodies or antibodies against tagged versions

    • Identify binding partners via mass spectrometry

    • Confirm specific interactions with immunoblotting

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified dsbB on sensor chips containing lipid nanodiscs

    • Flow potential interaction partners over the surface

    • Measure association/dissociation kinetics

    • Determine binding affinity constants (KD values)

  • Microscale Thermophoresis (MST):

    • Label dsbB with fluorescent dye

    • Titrate with unlabeled interaction partners

    • Measure changes in thermophoretic mobility

    • Calculate binding constants

In Vivo Interaction Studies:

  • Bacterial Two-Hybrid System (Specialized for Membrane Proteins):

    • Use split adenylate cyclase-based two-hybrid (BACTH) system designed for membrane protein interactions

    • Create fusion constructs of dsbB and potential partners

    • Co-express in reporter strain

    • Measure reporter gene activation (β-galactosidase activity)

  • In Vivo Crosslinking:

    • Treat intact bacteria with membrane-permeable crosslinkers

    • Immunoprecipitate dsbB complexes

    • Identify crosslinked partners by mass spectrometry

Structural Interaction Analysis:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Measure deuterium incorporation in dsbB alone versus in complex with partners

    • Map interaction sites based on protection from exchange

  • Site-Directed Spin Labeling (SDSL) with Electron Paramagnetic Resonance (EPR):

    • Introduce spin labels at specific sites in dsbB

    • Measure distance constraints between dsbB and partners

    • Generate structural models of interaction interfaces

The table below summarizes the key protein-protein interactions expected for dsbB and methods best suited to characterize them:

Interaction PartnerFunctional RelationshipRecommended Primary MethodSecondary Method
DsbAElectron transfer substrateSPR in nanodiscsIn vivo crosslinking
UbiquinoneElectron acceptorSpectrophotometric binding assaySite-directed mutagenesis
Respiratory chain componentsElectron transfer pathwayBACTH systemCo-immunoprecipitation
Novel virulence factorsPotential substratesProteome-wide crosslinkingCo-purification

These approaches provide complementary information about dsbB's interaction network, essential for understanding its role in S. boydii pathophysiology .

What strategies can be employed to enhance the yield and stability of recombinant S. boydii dsbB protein?

Enhancing yield and stability of recombinant S. boydii dsbB protein requires strategic interventions at multiple stages of the expression and purification process. The following comprehensive approach addresses common challenges in membrane protein production:

Genetic and Vector Optimization:

  • Codon Optimization:

    • Adjust codon usage to match E. coli preferences

    • Eliminate rare codons that could stall translation

    • Remove secondary structures in mRNA that impede translation initiation

  • Expression Vector Engineering:

    • Use tightly controlled promoters (T7lac or araBAD) to minimize leaky expression

    • Incorporate fusion partners that enhance solubility (MBP, SUMO, or Mistic for membrane proteins)

    • Include C-terminal purification tags to ensure only full-length protein is purified

Expression Condition Optimization:

  • Specialized Host Strains:

    • C41(DE3) or C43(DE3) - engineered for toxic membrane protein expression

    • Lemo21(DE3) - allows tunable expression intensity

    • SHuffle - enhanced disulfide bond formation in cytoplasm

  • Expression Parameters:

    • Implement auto-induction systems to achieve gradual protein production

    • Conduct temperature stepping: grow at 37°C, induce at 25°C, express at 16-18°C

    • Add chemical chaperones (betaine, sorbitol) to stabilize folding intermediates

Co-expression Strategies:

Research has shown that co-expression of Dsb proteins significantly enhances proper folding and yield of disulfide-containing proteins . For S. boydii dsbB, consider:

  • Chaperone Co-expression:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Co-express with other Dsb proteins (particularly DsbA, DsbC, and DsbD)

  • Creation of Engineered Strains:

    • Develop specialized expression strains with genomically integrated chaperones

    • Delete competing pathways to channel cellular resources toward target protein

Purification and Stability Enhancement:

  • Optimized Detergent Selection:

    • Screen multiple detergents (DDM, LMNG, GDN) for optimal extraction efficiency

    • Consider detergent mixtures for improved stability

  • Advanced Membrane Mimetics:

    • Reconstitute in nanodiscs for enhanced stability

    • Utilize SMALPs (Styrene Maleic Acid Lipid Particles) for detergent-free extraction

  • Stability Enhancers During Purification:

    • Add specific lipids (E. coli polar lipids) to purification buffers

    • Incorporate stabilizing additives (glycerol, arginine, specific binding partners)

Yield Enhancement Results:

Studies on related Dsb proteins have shown dramatic improvements in yield through optimization:

Optimization StrategyFold Improvement in YieldReference
Co-expression of DsbABCD10-fold increase in periplasmic yield
Low temperature induction (16°C)2.5-fold increase in total protein
Addition of calcium to growth media2-fold increase in properly folded protein
Use of C41(DE3) strain3-fold increase in membrane-inserted protein-

These combined approaches can transform challenging membrane proteins like dsbB from difficult expression targets into reliable research reagents available in milligram quantities .

How can researchers address issues with protein misfolding and aggregation during recombinant S. boydii dsbB expression?

Protein misfolding and aggregation represent major challenges in recombinant dsbB expression due to its membrane-associated nature and critical disulfide bonds. The following systematic troubleshooting approach addresses these issues:

Diagnostic Steps:

  • Characterize Aggregation State:

    • Analyze expression samples by SDS-PAGE with and without sample boiling

    • Perform western blot analysis of soluble versus insoluble fractions

    • Use size exclusion chromatography to quantify aggregation

  • Identify Aggregation Triggers:

    • Determine if aggregation occurs during expression or purification

    • Test if oxidizing/reducing conditions affect aggregation

    • Evaluate temperature sensitivity during expression

Strategic Solutions:

  • Expression Modifications:

    • Dramatically reduce expression temperature (16-18°C)

    • Decrease inducer concentration to slow expression rate

    • Implement pulse-expression protocols with cyclic induction periods

  • Buffer and Additive Optimization:

    • Screen stabilizing additives (10-15% glycerol, 150-300 mM NaCl, 5% sucrose)

    • Test kosmotropic agents (arginine, proline) to prevent aggregation

    • Include low concentrations of mild detergents during cell lysis

  • Co-expression Strategies:

    • Co-express with molecular chaperones (GroEL/ES system)

    • Co-express with all Dsb proteins (DsbA, DsbB, DsbC, and DsbD) to create a complete disulfide bond formation pathway

    • Consider co-expression with native Shigella membrane proteins that may form stabilizing complexes

Research has shown that co-expression of Dsb proteins can significantly reduce aggregation and improve proper folding of disulfide-containing proteins. Studies indicate that "overexpression of a set of Dsb proteins (DsbABCD)" led to marked stabilization of proteins that tend to aggregate when produced in E. coli . Specifically, DsbC overexpression appears critical, as it functions as a disulfide-bonded isomerase that can reshuffle incorrect disulfide bonds and prevent aggregation .

For membrane proteins like dsbB, specialized solutions include:

  • Using lipid-rich environments during extraction and purification

  • Employing amphipathic polymers for extraction directly from membranes

  • Rapid dilution methods from denaturing conditions for refolding

These approaches, particularly when combined, can significantly reduce aggregation and increase the yield of properly folded, functional dsbB protein.

What controls and validation steps are essential in studies involving S. boydii dsbB?

Rigorous controls and validation steps are essential to ensure the reliability and reproducibility of research involving S. boydii dsbB. The following comprehensive validation framework should be incorporated into experimental designs:

Expression and Purification Validation:

  • Protein Identity Confirmation:

    • N-terminal sequencing or mass spectrometry peptide mapping

    • Immunoblotting with specific antibodies against dsbB or affinity tags

    • Mass determination to confirm full-length protein

  • Purity Assessment:

    • SDS-PAGE with densitometry analysis (aim for >90-95% purity)

    • Size exclusion chromatography profiles

    • Negative controls from non-transformed cells processed identically

  • Structural Integrity Validation:

    • Circular dichroism to confirm secondary structure

    • Tryptophan fluorescence for tertiary structure analysis

    • Thermal stability assays to ensure proper folding

Functional Validation:

  • Enzymatic Activity Controls:

    • Positive control using well-characterized E. coli dsbB

    • Negative control using catalytically inactive dsbB mutant (C41S or C44S)

    • Dose-dependent activity measurements to confirm specificity

  • Membrane Association Validation:

    • Fractionation controls demonstrating membrane localization

    • Protease protection assays to confirm proper membrane topology

    • Reconstitution in liposomes to verify functionality in membrane environment

Interaction Studies Validation:

  • Binding Specificity Controls:

    • Competition assays with unlabeled proteins to verify specific binding

    • Non-binding protein controls (e.g., BSA) to assess non-specific interactions

    • Concentration-dependent binding studies to derive affinity constants

  • In Vivo Complementation Controls:

    • Positive control: wild-type dsbB complementation

    • Negative control: empty vector and catalytically inactive mutant

    • System validation with known dsbB-dependent phenotypes

Experimental Condition Validation:

  • Buffer and Reagent Quality Controls:

    • Freshly prepared reducing agents

    • Detergent critical micelle concentration verification

    • pH and ionic strength consistency checks

  • Instrument Calibration and Performance:

    • Standard curve generation for quantitative measurements

    • Regular calibration of analytical instruments

    • Temperature verification for thermal-sensitive experiments

A particularly critical validation approach for dsbB research is the use of complementation studies, where dsbB-deficient strains show clear phenotypic defects that can be rescued by functional recombinant dsbB . Research has demonstrated that "growth inhibition was largely alleviated either by addition of calcium to the medium or by overexpression of Dsb proteins," providing a clear phenotypic readout for functional validation .

What recent technological advances have enhanced our ability to study membrane proteins like S. boydii dsbB?

Recent technological breakthroughs have dramatically improved our capacity to study challenging membrane proteins like S. boydii dsbB, opening new avenues for structural and functional characterization:

Structural Biology Advancements:

  • Cryo-Electron Microscopy (Cryo-EM) Revolution:

    • Single-particle cryo-EM now achieves near-atomic resolution for membrane proteins

    • Sample preparation advances using novel grid technologies reduce preferred orientation issues

    • Direct electron detectors and computational processing improvements enable structure determination of smaller membrane proteins like dsbB

  • Advanced NMR Methodologies:

    • Solid-state NMR techniques for membrane proteins in native-like environments

    • Selective isotope labeling strategies that reduce spectral complexity

    • Paramagnetic relaxation enhancement for long-range distance constraints

  • Innovative Membrane Mimetics:

    • Nanodiscs with engineered membrane scaffold proteins for controlled bilayer size

    • Lipid cubic phase crystallization for membrane protein structure determination

    • Native nanodiscs extracted directly from bacterial membranes preserving native lipid environment

Functional Characterization Technologies:

  • Single-Molecule Approaches:

    • Single-molecule FRET to monitor conformational changes during catalysis

    • Electrical recording of single membrane protein activity

    • High-speed AFM to visualize membrane protein dynamics in real-time

  • Advanced Spectroscopic Methods:

    • Time-resolved FTIR spectroscopy to monitor redox changes in disulfide bonds

    • EPR spectroscopy with site-directed spin labeling for measuring distances in membrane proteins

    • Mass photometry for measuring membrane protein-protein interactions

Genetic and Expression System Innovations:

  • CRISPR-Cas9 Applications:

    • Precise genomic integration of modified dsbB variants

    • Creation of conditional knockout systems for essentiality testing

    • High-throughput mutagenesis to map structure-function relationships

  • Cell-Free Expression Systems:

    • Specialized membrane protein expression lysates

    • Co-translational integration into nanodiscs or liposomes

    • High-throughput expression screening platforms

These technological advances collectively transform our ability to work with challenging membrane proteins like dsbB, enabling researchers to address previously intractable questions about their structure, dynamics, and function in bacterial physiology and pathogenesis.

How might S. boydii dsbB be exploited as a potential antimicrobial target?

The essential role of dsbB in bacterial protein folding and virulence factor maturation makes it an attractive antimicrobial target with several strategic advantages over conventional antibiotics:

Target Rationale and Vulnerability:

  • Essential Function:

    • DsbB is essential for virulence in many pathogens

    • Disruption impacts multiple virulence factors simultaneously

    • No direct human homolog exists, potentially reducing toxicity

  • Conserved Active Site:

    • The redox-active cysteines and catalytic residues show high conservation

    • Structure-based drug design can target these essential elements

    • Potential for broad-spectrum activity against multiple enteric pathogens

Drug Development Strategies:

  • Direct Inhibition Approaches:

    • Small molecule inhibitors targeting the dsbB active site

    • Peptidomimetics that interrupt dsbB-DsbA interactions

    • Covalent inhibitors targeting the catalytic cysteines

  • Pathway Disruption Strategies:

    • Ubiquinone analogs that compete with the natural electron acceptor

    • Compounds that disrupt membrane association of dsbB

    • Molecules that alter the redox potential of the dsbB-DsbA system

Therapeutic Potential:

The antimicrobial potential of targeting dsbB is supported by research showing that disruption of the Dsb system significantly impacts bacterial virulence. Studies have demonstrated that "growth inhibition was largely alleviated either by addition of calcium to the medium or by overexpression of Dsb proteins," indicating the critical nature of this system . Additionally, the observation that "DsbC seems particularly important for alleviating growth inhibition" suggests that targeting the Dsb system could effectively compromise bacterial fitness .

Challenges and Considerations:

  • Membrane Protein Drug Targeting:

    • Achieving sufficient compound penetration to the periplasm

    • Maintaining specificity for bacterial over mammalian proteins

    • Addressing potential resistance mechanisms

  • Combinatorial Approaches:

    • Pairing with conventional antibiotics for synergistic effects

    • Combining with inhibitors of other bacterial redox systems

    • Using as an antivirulence agent rather than bactericidal compound

The development of dsbB inhibitors represents a promising approach to combat Shigella infections, particularly given the rising concerns about antibiotic resistance in enteric pathogens. By targeting a system essential for virulence factor maturation rather than bacterial growth directly, this strategy might also impose less selective pressure for resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.