Recombinant Shigella boydii serotype 4 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
frdC; SBO_4304; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPDAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit C anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: sbo:SBO_4304

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase subunit C (frdC) in Shigella boydii and what is its functional significance?

Fumarate reductase subunit C (frdC) is a membrane-bound protein component of the fumarate reductase complex in Shigella boydii. This complex plays a critical role in anaerobic respiration by catalyzing the reduction of fumarate to succinate, allowing the bacterium to use fumarate as a terminal electron acceptor under anaerobic conditions.

The frdC subunit specifically functions as an anchor protein that secures the catalytic components of the complex to the membrane. It contains transmembrane domains that form a hydrophobic environment essential for quinol binding and electron transfer processes .

In Shigella species, the fumarate reductase complex is particularly important during infection as it enables bacterial survival in the oxygen-limited environment of the intestinal lumen and within host cells, where access to oxygen is restricted .

How does the structure of recombinant Shigella boydii frdC differ from native frdC?

The recombinant Shigella boydii frdC protein typically includes specific modifications to facilitate laboratory research applications:

FeatureNative frdCRecombinant frdC
Length131 amino acids131 amino acids plus tag sequence
N-terminalNative sequenceOften modified with His-tag or other affinity tags
Post-translational modificationsNatural bacterial modificationsMay lack some modifications depending on expression system
Membrane associationIntegrated in bacterial membraneOften solubilized for purification
ConformationNative folding in lipid environmentMay have altered folding depending on purification methods

The recombinant protein generally maintains the primary amino acid sequence (MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW) but includes affinity tags for purification purposes .

What is the relationship between frdC and the fumarate and nitrate reductase (FNR) regulator?

While frdC is a structural component of the fumarate reductase complex, FNR (fumarate and nitrate reductase regulator) is a global transcriptional regulator that controls the expression of genes involved in anaerobic respiration, including the frd gene cluster.

Key relationships include:

  • FNR acts as an oxygen sensor that becomes active under low oxygen conditions

  • When active, FNR upregulates the expression of the fumarate reductase operon (frdABCD) that includes frdC

  • In Shigella dysenteriae, the FNR gene is located in proximity to the stx genes encoding Shiga toxin

  • FNR mediates the blocking of type III secretion system (T3SS) in anaerobic conditions, connecting respiratory adaptation to virulence regulation

This relationship demonstrates how Shigella integrates environmental sensing (oxygen levels) with metabolic adaptation and potentially virulence factor expression .

What are the optimal conditions for expression and purification of recombinant Shigella boydii frdC?

Successful expression and purification of recombinant Shigella boydii frdC requires specific conditions that accommodate its hydrophobic membrane protein nature:

Expression System and Conditions:

  • Host organism: E. coli is the preferred expression system due to its genetic similarity to Shigella

  • Expression vector: Vectors with N-terminal His-tag are commonly used

  • Induction: IPTG induction at lower temperatures (18-25°C) often yields better results for membrane proteins

  • Growth conditions: Anaerobic or microaerobic conditions can improve expression by mimicking the natural environment for frdC function

Purification Protocol:

  • Cell lysis using detergent-based methods (rather than mechanical disruption)

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity chromatography using Ni-NTA resin for His-tagged proteins

  • Size exclusion chromatography for final purification

Storage Recommendations:

  • Store in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • For long-term storage, add 50% glycerol and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

How should researchers design experiments to study frdC function in anaerobic conditions?

When designing experiments to study frdC function under anaerobic conditions, consider the following methodological approach:

Experimental Design Framework:

  • Select appropriate controls:

    • Positive control: Wild-type Shigella boydii

    • Negative control: frdC knockout mutant

    • Complementation control: frdC knockout with plasmid-encoded frdC

  • Consider implementing a Completely Randomized Design (CRD) for laboratory experiments:

    • Assign treatments randomly to experimental units

    • Ensure homogeneity of experimental conditions

    • Include adequate replication (minimum 5 replicates per treatment)

  • Key parameters to monitor:

    • Growth rates under anaerobic conditions

    • Fumarate reduction activity

    • Membrane potential

    • ATP production

    • Expression of related genes

  • Anaerobic technique options:

    • Anaerobic chamber with controlled atmosphere

    • Sealed anaerobic culture vessels with oxygen scavengers

    • Biological oxygen depletion using reducing agents

The experimental design should incorporate methods to verify anaerobic conditions, such as using resazurin indicators or dissolved oxygen probes to ensure consistent environmental conditions .

What methods are most effective for analyzing frdC interactions with other components of the respiratory chain?

To effectively analyze frdC interactions with other components of the respiratory chain, researchers should employ multiple complementary approaches:

Protein-Protein Interaction Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against frdC or its tag to pull down interacting proteins

  • Bacterial two-hybrid systems: Specifically adapted for membrane protein interactions

  • Cross-linking mass spectrometry: To capture transient protein-protein interactions within the membrane

  • Blue native PAGE: For analysis of intact membrane protein complexes

Functional Analysis Methods:

  • Membrane reconstitution assays: Incorporating purified components into liposomes

  • Electron transfer measurements: Using artificial electron donors/acceptors

  • Proton translocation assays: To measure coupling between electron transport and proton movement

Structural Analysis:

  • Cryo-electron microscopy: For structural analysis of the entire complex

  • Site-directed mutagenesis: Combined with activity assays to identify critical residues

  • Hydrogen-deuterium exchange mass spectrometry: To examine protein dynamics and interactions

When designing these experiments, it's essential to maintain anaerobic conditions throughout sample preparation and analysis to preserve the native state of the protein complexes .

How does the function of frdC in Shigella boydii compare to orthologous proteins in other Shigella species and related Enterobacteriaceae?

Comparative analysis of frdC across Shigella species and related Enterobacteriaceae reveals important evolutionary and functional insights:

SpeciesfrdC LengthKey Sequence DifferencesFunctional Implications
S. boydii serotype 4131 aaReference sequenceStandard activity profile
S. boydii serotype 18131 aaConservative substitutions at positions 50 (K→N) and 76 (P→A)Minor impact on membrane association
S. sonnei131 aa100% identity with S. boydii serotype 4Functionally identical
S. flexneri131 aa>99% identityNearly identical function
E. coli131 aa>95% identityVery similar function, established model system

Notably, despite the high sequence similarity, there are documented differences in regulation patterns and expression levels that may contribute to pathotype-specific virulence strategies. These differences are likely driven by upstream regulatory elements rather than the protein sequence itself .

What is the role of frdC in Shigella pathogenesis and intracellular survival?

The role of frdC in Shigella pathogenesis and intracellular survival is multifaceted and integrated with bacterial metabolism and adaptation to host environments:

  • Adaptation to anaerobic/microaerobic environments:

    • The intestinal lumen and intracellular compartments are oxygen-limited

    • frdC enables anaerobic respiration using fumarate as terminal electron acceptor

    • This provides metabolic flexibility critical for colonization and persistence

  • Metabolic reprogramming during infection:

    • Upon entering host cells, Shigella shifts to fermentation pathways

    • The tricarboxylic acid (TCA) cycle components are downregulated

    • frdC-containing complexes help maintain redox balance during this metabolic shift

  • Connection to virulence regulation:

    • FNR (fumarate and nitrate reductase regulator) controls both respiratory genes and virulence factors

    • Under anaerobic conditions, FNR mediates the blocking of T3SS secretion

    • This creates a link between oxygen sensing, metabolism, and virulence expression

  • Intracellular survival mechanisms:

    • Shigella captures host pyruvate for its metabolism

    • The fumarate reductase complex contributes to maintaining bacterial ATP production

    • This metabolic adaptation is essential for efficient intracellular replication

Research has demonstrated that mutants impaired in anaerobic respiration show reduced intracellular persistence, highlighting the importance of these metabolic pathways in the infection process .

How can recombinant frdC be used in the development of novel antimicrobial strategies against Shigella infections?

Recombinant frdC offers several promising avenues for the development of novel antimicrobial strategies against multi-drug resistant Shigella infections:

  • Structure-based drug design:

    • Recombinant frdC provides structural templates for designing inhibitors

    • Targeting the membrane-anchoring function could disrupt respiratory chain assembly

    • High-resolution structural data combined with in silico screening can identify potential binding pockets

  • Attenuated vaccine development:

    • frdC mutants with reduced anaerobic growth capacity could serve as live attenuated vaccine candidates

    • These would maintain immunogenicity while having reduced virulence

    • Controlled expression of frdC could create strains with predictable attenuation profiles

  • Diagnostic applications:

    • Recombinant frdC can be used to develop specific antibodies for diagnostic tests

    • PCR-based detection of frdC sequence variants could aid in strain identification

    • This is particularly relevant given the emergence of novel serotypes like S. flexneri 4s that show multidrug resistance

  • Adjunctive therapy approaches:

    • Small molecule inhibitors of fumarate reductase activity

    • Peptides that interfere with frdC membrane integration

    • Compounds that disrupt interaction between frdC and other complex components

This approach is particularly promising given the increasing prevalence of multidrug-resistant Shigella strains worldwide, including extensively drug-resistant (XDR) strains recently reported in the United States and globally .

What are common challenges when working with recombinant frdC and how can they be overcome?

Researchers working with recombinant frdC frequently encounter several challenges due to its hydrophobic nature and membrane association:

ChallengeCauseSolution
Low expression levelsToxicity to host cells; membrane protein expression burdenUse tightly controlled inducible promoters; lower induction temperature (16-20°C); use specialized E. coli strains (C41/C43)
Inclusion body formationProtein misfolding; overwhelming host folding machineryCo-express with chaperones (GroEL/GroES); use fusion partners that enhance solubility
Poor solubilizationHighly hydrophobic transmembrane domainsScreen different detergents; try detergent mixtures; use amphipols or nanodiscs for stabilization
Loss of activity during purificationDetergent-induced conformational changesUse milder detergents; maintain lipid content during purification; consider native membrane extracts
Aggregation during storageDetergent micelle instabilityAdd glycerol (50%) to storage buffer; store at -20°C/-80°C in small aliquots; avoid freeze-thaw cycles

Additionally, researchers can explore alternative approaches such as:

  • Fusion strategies with bacterial membrane anchors with C-terminus facing the cytoplasmic site (particularly YcjF variants)

  • Co-expression with redox partners to improve functional expression

  • Implementation of glucose dehydrogenase co-expression to provide additional NADP molecules needed for proper folding

These strategies have been shown to increase yield and stability of recombinant membrane proteins from related bacterial systems .

How should researchers validate the functional activity of purified recombinant frdC?

Comprehensive validation of recombinant frdC functional activity requires multiple complementary approaches:

Biochemical Assays:

  • Reconstitution assays:

    • Incorporate purified frdC into liposomes or nanodiscs

    • Add purified frdA and frdB subunits to reconstitute the complex

    • Measure fumarate reduction using appropriate electron donors (menaquinol)

  • Spectroscopic methods:

    • Monitor changes in absorbance at 600 nm during fumarate reduction

    • Measure quinone reduction/oxidation by absorbance changes

    • Use fluorescent probes to monitor membrane potential generation

Structural and Biophysical Validation:

  • Circular dichroism spectroscopy: Verify secondary structure composition

  • Thermal shift assays: Assess protein stability and ligand binding

  • Limited proteolysis: Confirm proper folding by resistance to digestion

Functional Complementation:

  • In vivo complementation: Test if recombinant frdC can restore anaerobic growth in frdC-deficient strains

  • Membrane integration analysis: Confirm proper insertion into membranes

When analyzing activity data, researchers should compare the kinetic parameters (Km, Vmax) of the recombinant protein to published values for native enzyme complexes. Additionally, consider environmental factors such as pH, ionic strength, and lipid composition that may affect activity measurements .

How can researchers address data inconsistencies when studying frdC function across different experimental systems?

When faced with data inconsistencies in frdC research across different experimental systems, researchers should implement a systematic approach to identify and address potential sources of variation:

Sources of Experimental Variation:

  • Expression system differences:

    • Different E. coli strains may introduce host-specific effects

    • Variations in expression vectors can affect protein folding and activity

    • Induction conditions impact protein quality and yield

  • Purification method effects:

    • Detergent choice significantly influences membrane protein properties

    • Presence/absence of lipids during purification affects stability

    • Different tags may interfere with function to varying degrees

  • Assay condition variables:

    • Buffers, pH, and ionic strength affect activity measurements

    • Temperature variations impact enzyme kinetics

    • Different electron donors/acceptors yield different activity profiles

Standardization Strategies:

  • Implement statistical design of experiments (DOE):

    • Use completely randomized design (CRD) for laboratory experiments

    • Include sufficient replication (n ≥ 5) to account for variability

    • Apply proper statistical analysis (ANOVA) to determine significant factors

  • Develop reference standards:

    • Create a well-characterized frdC preparation as internal standard

    • Include consistent positive and negative controls across experiments

    • Use orthogonal methods to validate key findings

  • Metadata documentation:

    • Record detailed experimental conditions and protocols

    • Track lot numbers of reagents and materials

    • Document environmental factors that may influence results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.