Recombinant Shigella boydii serotype 4 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us for prioritized development.
Synonyms
frdD; SBO_4305; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. The FrdD subunit anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: sbo:SBO_4305

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase subunit D (frdD) in Shigella boydii serotype 4?

Fumarate reductase subunit D (frdD) is a 119-amino acid protein that functions as an essential anchoring component of the fumarate reductase complex in Shigella boydii serotype 4 (strain Sb227). The protein belongs to the FrdD family and plays a crucial role in attaching the catalytic components of the fumarate reductase complex to the cytoplasmic membrane . The protein has a molecular weight of approximately 13.1 kDa and contains hydrophobic regions that facilitate membrane integration .

What is the biological context of Shigella boydii serotype 4?

Shigella boydii is a Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacterium first discovered in 1897. It is closely related to E. coli and is one of the leading bacterial causes of diarrhea worldwide, particularly affecting children in African and South Asian regions . Shigella species are classified into three serogroups and one serotype: S. dysenteriae, S. flexneri, S. boydii, and S. sonnei. Among these, S. flexneri is the most frequently isolated species globally, accounting for approximately 60% of isolations . Shigella boydii serotype 4 (strain Sb227) represents a specific variant within the S. boydii group, characterized by unique surface antigens and genetic markers.

What expression systems are optimal for producing recombinant frdD?

Based on current methodologies for similar membrane proteins, several expression systems can be considered for producing recombinant frdD:

Expression SystemAdvantagesLimitationsRecommended for frdD
E. coliHigh yield, cost-effective, rapid growthMay form inclusion bodies with membrane proteinsYes, with optimization
Yeast (P. pastoris)Post-translational modifications, proper foldingLonger production timeYes, for functional studies
BaculovirusEukaryotic processing, high expressionComplex system, higher costFor structural studies
Mammalian cellsNative-like folding and modificationsExpensive, low yieldNot primary choice

For initial characterization studies, E. coli-based expression systems are most commonly employed due to their efficiency and cost-effectiveness, though optimization of solubilization conditions may be necessary for this membrane protein . For functional studies requiring proper membrane insertion, yeast-based systems might offer advantages.

How can I optimize purification protocols for recombinant frdD?

Purification of recombinant frdD requires specialized approaches due to its membrane-associated nature:

  • Membrane fraction isolation: After cell lysis, differential centrifugation should be employed to isolate membrane fractions.

  • Detergent solubilization: Screen multiple detergents (n-Dodecyl β-D-maltoside, Triton X-100, CHAPS) at various concentrations to identify optimal solubilization conditions.

  • Affinity chromatography: If expressed with affinity tags (His, GST), use corresponding affinity resins under detergent-containing conditions.

  • Size exclusion chromatography: For final polishing and to verify oligomeric state.

  • Stability assessment: Monitor protein stability in various buffer conditions using thermal shift assays.

Recommended buffer composition during purification should include 50 mM Tris-HCl pH 7.5-8.0, 150-300 mM NaCl, 5-10% glycerol, and appropriate detergent above its critical micelle concentration . For long-term storage, addition of 50% glycerol and storage at -20°C or -80°C is recommended to prevent repeated freeze-thaw cycles.

How can recombinant frdD be used in structural biology studies?

Investigating the structure of recombinant frdD presents unique challenges and opportunities:

  • X-ray crystallography: Due to its membrane nature, crystallization requires specialized approaches:

    • Lipidic cubic phase crystallization

    • Bicelle-based crystallization

    • Co-crystallization with antibody fragments

  • Cryo-electron microscopy: Particularly suitable for membrane proteins like frdD, especially when studied as part of the entire fumarate reductase complex.

  • NMR spectroscopy: For studying dynamics and interactions:

    • Solution NMR for detergent-solubilized protein

    • Solid-state NMR for membrane-embedded studies

  • Computational approaches:

    • Molecular dynamics simulations to understand membrane integration

    • Homology modeling based on related FrdD family proteins

The tertiary structure elucidation can follow approaches similar to those used in studying recombinant RNAs, where understanding the tertiary structure enabled design improvements . When designing structural biology experiments, consider expressing frdD in fusion with stability-enhancing proteins or tags that facilitate crystallization.

What biochemical assays are most informative for characterizing frdD function?

To characterize the function of recombinant frdD, researchers should consider these methodological approaches:

  • Membrane integration assays:

    • Proteoliposome reconstitution to assess membrane insertion

    • Fluorescence-based membrane association assays

  • Protein-protein interaction studies:

    • Pull-down assays with other fumarate reductase subunits

    • Crosslinking studies to identify interaction partners

    • Surface plasmon resonance to quantify binding affinities

  • Functional reconstitution:

    • Activity assays of reconstituted fumarate reductase complex

    • Measurement of proton pumping in proteoliposomes

  • Mutational analysis:

    • Alanine scanning of key residues to identify functional domains

    • Truncation studies to map minimal anchoring regions

These approaches help delineate how frdD contributes to anchoring the catalytic components of the fumarate reductase complex to the cytoplasmic membrane, its primary known function .

How does frdD compare across different Shigella serotypes and related species?

Comparative analysis of frdD across Shigella serotypes provides evolutionary insights:

Species/SerotypeSequence Identity to S. boydii serotype 4 frdDKey DifferencesFunctional Implications
S. boydii (other serotypes)95-99%Minor variations in transmembrane regionsPotential host adaptation
S. flexneri~90-95%Differences in hydrophobic domainsMay affect membrane association
S. dysenteriae~85-90%Variable C-terminal regionCould influence complex stability
E. coli~80-85%More diverse sequenceReflects evolutionary divergence

This comparison can be conducted using bioinformatic tools like BLAST, multiple sequence alignment, and phylogenetic analysis. The patterns of conservation can highlight functionally critical residues maintained across evolution versus variable regions that might confer species-specific properties .

Researchers can employ Pulsed-Field Gel Electrophoresis (PFGE) to differentiate among strains within serotype 4, as this technique has proven valuable for strain identification and differentiation within Shigella species .

What is the role of frdD in bacterial metabolism and virulence?

The fumarate reductase complex, of which frdD is an integral component, plays significant roles in bacterial metabolism and potentially in virulence:

  • Anaerobic respiration: The fumarate reductase complex catalyzes the reduction of fumarate to succinate during anaerobic respiration, allowing bacteria to use fumarate as an alternative terminal electron acceptor when oxygen is limited.

  • Metabolic adaptation: This capability may enhance survival in the anaerobic or microaerobic environments encountered during host colonization.

  • Potential virulence connections:

    • Energy generation during infection process

    • Adaptation to the intestinal environment

    • Possible contribution to acid resistance

Experimental approaches to investigate these connections include:

  • Creation of frdD knockout mutants and virulence assessment

  • Transcriptomic analysis under infection-relevant conditions

  • Metabolomic profiling during host cell interaction

  • In vivo colonization and persistence studies

Understanding these roles may provide insights into pathogenicity mechanisms and identify potential therapeutic targets.

How can recombinant frdD be utilized in diagnostic development?

Recombinant proteins have demonstrated value as antigens in diagnostic assays, offering advantages of purity, specificity, and reproducibility . For frdD-based diagnostics:

  • ELISA development:

    • Direct coating of recombinant frdD as capture antigen

    • Optimization of protein concentration (typically 1-5 μg/ml)

    • Validation with confirmed positive and negative serum panels

  • Serological differentiation:

    • Assessment of serotype-specific antibody responses

    • Potential for distinguishing between Shigella serotypes

  • Performance considerations:

    • Sensitivity and specificity assessment

    • Cross-reactivity testing with related enteric pathogens

    • Stability studies under various storage conditions

When developing such assays, researchers should follow approaches similar to those documented for other recombinant proteins in diagnostic applications, where sensitivity and specificity values above 90% have been achieved .

What strategies can address poor expression or solubility issues with recombinant frdD?

Membrane proteins like frdD often present expression and solubility challenges. Consider these methodological solutions:

  • Expression optimization:

    • Test multiple E. coli strains (BL21(DE3), C41/C43, Rosetta)

    • Evaluate different induction parameters (temperature, IPTG concentration)

    • Use specialized vectors with tunable promoters

  • Fusion partner approaches:

    • N-terminal fusions with solubility enhancers (MBP, SUMO, Trx)

    • C-terminal fusions with stability tags (GFP for folding assessment)

  • Solubilization strategies:

    • Systematic detergent screening (non-ionic, zwitterionic, ionic)

    • Detergent concentration optimization

    • Use of mixed micelles or amphipols

  • Alternative approaches:

    • Cell-free expression systems

    • Co-expression with chaperones

    • Truncation constructs focusing on specific domains

For persistent challenges, consider expressing just the soluble domains or using peptide fragments for epitope-specific studies if full-length protein cannot be obtained in functional form.

How can researchers validate the proper folding and functionality of recombinant frdD?

Validating proper folding and functionality of membrane proteins requires specialized approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure

    • Tryptophan fluorescence for tertiary structure assessment

    • Limited proteolysis to identify correctly folded domains

  • Membrane interaction validation:

    • Liposome binding assays

    • Monolayer insertion measurements

    • Fluorescence-based membrane partitioning studies

  • Complex formation assessment:

    • Co-immunoprecipitation with other fumarate reductase subunits

    • Size exclusion chromatography to verify complex assembly

    • Native PAGE to analyze oligomeric state

  • Functional reconstitution:

    • Integration into proteoliposomes

    • Activity measurements of reconstituted complexes

    • Electron microscopy to visualize membrane insertion

These validation steps are essential to ensure that research findings accurately reflect the native properties of the protein rather than artifacts of the recombinant expression system.

What emerging technologies could enhance our understanding of frdD?

Several cutting-edge approaches could significantly advance frdD research:

  • Structural biology innovations:

    • Micro-electron diffraction for membrane protein crystals

    • Single-particle cryo-EM with improved resolution for smaller proteins

    • Integrative structural biology combining multiple data sources

  • System-level analysis:

    • Interactomics approaches to map the complete protein interaction network

    • Multi-omics integration to understand regulation and function

    • Spatiotemporal analysis of protein localization during infection

  • Advanced genetic approaches:

    • CRISPR-based precise genome editing in Shigella

    • Conditional knockdown systems for essential genes

    • High-throughput mutagenesis and phenotyping

  • Computational methods:

    • Machine learning for structure prediction

    • Molecular dynamics simulations at extended timescales

    • Quantum mechanics/molecular mechanics for reaction mechanisms

These technologies could reveal nuanced aspects of frdD function that current methods cannot adequately address.

How might frdD research contribute to antimicrobial development?

The fumarate reductase complex represents a potential antimicrobial target, with frdD offering unique opportunities:

  • Target validation approaches:

    • Essentiality assessment under infection-relevant conditions

    • Phenotypic consequences of inhibition

    • In vivo significance in infection models

  • Drug discovery strategies:

    • High-throughput screening for membrane disruptors

    • Fragment-based drug design targeting protein-protein interfaces

    • Structure-based virtual screening for binding sites

  • Therapeutic considerations:

    • Specificity for bacterial vs. human proteins

    • Druggability assessment of binding pockets

    • Potential for resistance development

  • Experimental design recommendations:

    • Combine biochemical, structural, and cellular approaches

    • Develop specific assays for complex assembly inhibition

    • Establish clear criteria for hit-to-lead progression

This research direction could potentially address the growing problem of antimicrobial resistance in enteric pathogens like Shigella.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.