Recombinant Shigella boydii serotype 4 Large-conductance mechanosensitive channel (mscL)

What is the molecular structure of Shigella boydii serotype 4 Large-conductance mechanosensitive channel (mscL)?

The Shigella boydii serotype 4 Large-conductance mechanosensitive channel (mscL) is a membrane protein with 136 amino acids. Its amino acid sequence is: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLAEIRDLLKEQNNRS . The protein contains hydrophobic regions that anchor it within the bacterial membrane, forming a channel that responds to changes in membrane tension. The structure is characterized by transmembrane helices that rearrange during channel opening, creating a pore large enough for solutes to pass through.

What are the key differences between mscL and other mechanosensitive channels in bacteria?

The bacterial mechanosensitive channel family includes several distinct types, with mscL (Large-conductance) and MscS (Small-conductance) being the most well-characterized. Key differences include:

While MscS-family channels dramatically enhance bactericidal effects of aminoglycosides against bacteria under hypoionic shock conditions, mscL demonstrates weaker enhancement compared to these other channels .

What are the most effective expression systems for producing Recombinant Shigella boydii serotype 4 mscL protein?

The effective expression of Recombinant Shigella boydii serotype 4 mscL requires careful consideration of the expression system. While multiple expression platforms are potentially suitable (E. coli, yeast, baculovirus, or mammalian cells) , E. coli typically represents the preferred system for bacterial membrane proteins like mscL due to its high yield, cost-effectiveness, and appropriate post-translational modifications for bacterial proteins.

For optimal expression in E. coli:

• Select an appropriate E. coli strain (BL21(DE3), C41(DE3), or C43(DE3)) specifically designed for membrane protein expression

• Use a vector with an inducible promoter (T7 or tac) for controlled expression

• Incorporate a fusion tag (His6, MBP, or GST) to facilitate purification

• Optimize induction conditions (temperature, IPTG concentration, and duration) to minimize inclusion body formation

• Consider co-expression with chaperones to enhance proper folding

The expression of functional mscL typically requires verification of proper membrane integration, which can be confirmed through activity assays that measure channel conductance or response to membrane tension.

What are the methodological challenges in purifying functional Recombinant Shigella boydii serotype 4 mscL?

Purification of functional mscL presents several methodological challenges due to its hydrophobic nature and membrane localization:

• Membrane extraction: Efficient solubilization requires screening multiple detergents (DDM, LDAO, or C12E8) at various concentrations to maintain protein stability and functionality

• Detergent exchange: Throughout purification, maintaining an appropriate detergent concentration above its critical micelle concentration is crucial to prevent protein aggregation

• Functional assessment: Verifying channel functionality requires reconstitution into liposomes or nanodiscs followed by electrophysiological measurements or fluorescence-based flux assays

• Protein stability: The protein may exhibit limited stability in detergent solutions, necessitating optimization of buffer conditions (pH, salt concentration, glycerol content) and potential addition of stabilizing lipids

• Oligomeric state: Ensuring the correct pentameric assembly of the channel is essential for function and requires careful monitoring through size exclusion chromatography or analytical ultracentrifugation

A systematic approach to these challenges involving detergent screening and stability assays is critical for obtaining functionally active mscL suitable for structural and functional studies.

How can researchers effectively design experiments to study the role of Shigella boydii mscL in antibiotic resistance?

Designing experiments to investigate the role of Shigella boydii mscL in antibiotic resistance requires a multi-faceted approach:

• Genetic manipulation strategies:

  • Generate mscL knockout strains using techniques similar to those used for other bacterial genes, such as replacing the mscL gene with a chloramphenicol acetyltransferase (CAT) gene using the RED recombination system

  • Create point mutations in key residues of the channel using site-directed mutagenesis

  • Develop complementation strains expressing wild-type or mutant mscL for rescue experiments

• Antibiotic susceptibility testing:

  • Compare minimum inhibitory concentrations (MICs) between wild-type, mscL-knockout, and complemented strains

  • Perform time-kill assays under various osmotic conditions to assess survival

  • Evaluate the effects of hypoionic shock treatment (2-minute exposure to pure water) followed by aminoglycoside treatment

• Mechanism investigation:

  • Measure antibiotic uptake using fluorescently labeled aminoglycosides or radiolabeled compounds

  • Assess membrane permeability changes using fluorescent dyes

  • Monitor channel activity during antibiotic exposure using patch-clamp electrophysiology

• In vivo relevance assessment:

  • Utilize animal infection models (such as the streptomycin-pretreated mouse model) to evaluate the efficacy of combining hypoionic shock with aminoglycosides against wild-type and mscL-deficient strains

  • Assess bacterial persistence and colonization in these models

This experimental framework allows for comprehensive characterization of how mscL contributes to antibiotic susceptibility, particularly regarding aminoglycoside uptake and efficacy under hypoionic conditions.

What methodologies can be used to investigate the interaction between mscL and aminoglycoside antibiotics?

Investigating the interaction between mscL and aminoglycoside antibiotics requires multiple complementary approaches:

• Molecular docking and computational modeling:

  • Develop in silico models of mscL based on homologous structures

  • Perform molecular docking studies to identify potential aminoglycoside binding sites

  • Conduct molecular dynamics simulations to understand conformational changes during interaction

• Site-directed mutagenesis:

  • Identify putative binding pocket residues through sequence analysis

  • Generate point mutations at these sites and assess their impact on aminoglycoside uptake and potentiation

  • Create chimeric channels with domains from related mechanosensitive channels to map interaction regions

• Direct binding assays:

  • Utilize isothermal titration calorimetry (ITC) with purified mscL in appropriate membrane mimetics

  • Perform surface plasmon resonance (SPR) to measure binding kinetics

  • Use fluorescence-based assays with fluorescently labeled aminoglycosides to visualize binding

• Functional characterization:

  • Employ patch-clamp electrophysiology to measure channel conductance in the presence of aminoglycosides

  • Conduct liposome-based flux assays to assess aminoglycoside transport through reconstituted channels

  • Evaluate aminoglycoside uptake in bacterial cells expressing wild-type or mutant mscL

Similar approaches have been used to identify a putative streptomycin-binding pocket in the MscS channel, which was critical for streptomycin uptake and potentiation . The weaker enhancement effect of mscL compared to MscS-family channels provides an interesting comparative system for understanding structure-function relationships in aminoglycoside transport.

How does the mechanosensitive channel function differ between Shigella boydii serotype 4 and other Shigella species?

The mechanosensitive channel function across different Shigella species exhibits both conserved mechanisms and species-specific variations that may reflect adaptation to different ecological niches:

• Sequence and structural comparison:
  Analysis of mscL sequences from Shigella boydii serotype 4, Shigella flexneri, Shigella dysenteriae, and Shigella sonnei reveals high conservation in channel core domains but divergence in peripheral regions. These differences may affect channel gating properties and interactions with other cellular components.

• Expression regulation:
  Different Shigella species show varied expression patterns of mscL in response to environmental stressors. For example, gene expression studies have documented differential upregulation of mechanosensitive channels during osmotic stress responses.

• Functional diversity:
  Electrophysiological studies comparing channel conductance and gating thresholds between species highlight functional adaptations, potentially related to their distinct pathogenic mechanisms and host interaction strategies.

• Interaction with bacterial pathogenesis:
  The role of mscL in virulence may vary between species. For instance, Shigella flexneri 2a has been extensively studied in mouse models of infection , while less is known about the specific contributions of mscL to Shigella boydii serotype 4 pathogenesis.

• Antibiotic susceptibility contributions:
  The relative contribution of mscL to aminoglycoside susceptibility appears to vary between species, with evidence suggesting that while MscS family channels may play a dominant role in antibiotic uptake , the precise balance between mscL and other channels may differ across Shigella species.

Understanding these differences requires comparative studies using recombinant channels from multiple species expressed under identical conditions, combined with structural studies and in vivo pathogenesis models.

What are the potential applications of recombinant mscL in developing novel antimicrobial strategies against Shigella infections?

Recombinant mscL has several potential applications in developing novel antimicrobial strategies against Shigella infections:

• Channel activator development:

  • Design small molecules that specifically bind to and activate mscL, increasing bacterial membrane permeability

  • Screen for compounds that lower the activation threshold of mscL, making it more sensitive to normal physiological changes in membrane tension

  • Develop peptide mimetics based on the channel's structure that can interact with and modulate its function

• Adjuvant therapy approaches:

  • Utilize hypoionic shock conditions that activate mechanosensitive channels to enhance aminoglycoside uptake

  • Develop combination therapies that target both mscL and other bacterial structures to increase antibiotic efficacy

  • Create formulations that locally alter osmotic conditions at infection sites to activate channels

• Vaccine development platforms:

  • Investigate recombinant mscL as a potential protein subunit vaccine component

  • Design chimeric vaccines incorporating both mscL and other Shigella antigens (similar to the approach using IpaB fusion with Salmonella outer membrane protein)

  • Utilize mscL-expressing attenuated bacterial strains as live vaccine vehicles

• Diagnostic applications:

  • Develop antibodies against serotype-specific regions of mscL for diagnostic assays

  • Create biosensors utilizing the mechanosensitive properties of the channel for detection of Shigella in clinical samples

  • Design PCR-based assays targeting mscL genes for rapid identification of specific Shigella serotypes

These approaches take advantage of the critical role of mechanosensitive channels in bacterial physiology and their involvement in antibiotic uptake mechanisms, potentially addressing the significant public health challenge posed by Shigella infections, particularly in developing regions.

What are the common challenges in working with recombinant mechanosensitive channels and how can they be addressed?

Working with recombinant mechanosensitive channels presents several technical challenges that require specific troubleshooting approaches:

These challenges have been documented across studies of various mechanosensitive channels, including those from Shigella species and related bacteria. Addressing these issues requires systematic optimization of protocols for each specific channel variant.

How can researchers validate the functionality of recombinant mscL after expression and purification?

Validating the functionality of recombinant mscL after expression and purification is critical for ensuring experimental reliability. Multiple complementary approaches should be employed:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to confirm proper secondary structure composition

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify pentameric assembly

  • Negative-stain electron microscopy to visualize channel complexes

• Membrane incorporation verification:

  • Flotation assays using reconstituted proteoliposomes

  • Fluorescence resonance energy transfer (FRET) between labeled protein and membrane probes

  • Accessibility assays using membrane-impermeable labeling reagents

• Direct functional measurements:

  • Patch-clamp electrophysiology of reconstituted channels to measure conductance and tension sensitivity

  • Stopped-flow fluorescence assays using fluorescent dyes to monitor solute flux through channels

  • Osmotic shock survival assays in mscL-knockout bacteria complemented with the purified and reconstituted protein

• Tension sensitivity characterization:

  • Micropipette aspiration of giant unilamellar vesicles containing reconstituted mscL

  • Analysis of channel activation thresholds using controlled application of membrane tension

  • Comparison of tension sensitivity parameters with native channels

• Aminoglycoside interaction assessment:

  • Measurement of aminoglycoside binding using fluorescence anisotropy

  • Functional assays in the presence of aminoglycosides to assess transport capacity

  • Comparison with MscS-family channels, which show stronger aminoglycoside potentiation effects

These validation approaches ensure that the recombinant mscL retains both its structural integrity and functional capabilities, making it suitable for further experimental applications.

What are the emerging research questions regarding mechanosensitive channels in Shigella pathogenesis?

Several emerging research questions are shaping the future of mechanosensitive channel research in Shigella pathogenesis:

• Host-pathogen interaction dynamics:

  • How do mechanosensitive channels contribute to bacterial adaptation during different stages of infection?

  • Are host-derived signals capable of modulating mechanosensitive channel activity during infection?

  • Does the activation state of mechanosensitive channels influence virulence gene expression?

• Therapeutic targeting potential:

  • Can mechanosensitive channels be selectively targeted to increase antibiotic efficacy without affecting commensal bacteria?

  • How do channels like mscL contribute to persister cell formation and antibiotic tolerance?

  • Could combined hypoionic treatment with aminoglycosides be effective against Shigella infections in clinical settings?

• Strain and serotype variation significance:

  • How do variations in mechanosensitive channel sequences between Shigella strains affect their functional properties?

  • Are differences in channel activity correlated with clinical outcomes or epidemiological patterns?

  • Could serotype-specific mechanisms involving mechanosensitive channels explain differences in disease severity?

• Regulatory network integration:

  • How is mscL expression coordinated with other stress response systems during infection?

  • What transcription factors regulate mscL expression during different environmental conditions?

  • How does mscL activity influence global bacterial physiology beyond osmotic regulation?

These questions represent important frontiers in understanding the broader role of mechanosensitive channels beyond their classical functions as osmotic safety valves, particularly in the context of bacterial pathogenesis and antimicrobial resistance.

How might comparative studies between different Shigella serotypes inform vaccine development strategies?

Comparative studies between different Shigella serotypes offer valuable insights for vaccine development strategies:

• Identification of conserved antigens:

  • Mechanosensitive channels like mscL contain both variable and conserved regions across serotypes

  • Detailed sequence analysis and epitope mapping across serotypes can identify universally conserved regions that might serve as broadly protective vaccine targets

  • Structural studies comparing channel architecture between serotypes can reveal functionally critical domains suitable for targeting

• Serotype-specific immunity considerations:

  • Understanding how mechanosensitive channels contribute to the unique characteristics of each serotype

  • Developing chimeric antigens that incorporate protective epitopes from multiple serotypes (similar to the approach with IpaB-T2544 fusion protein)

  • Analyzing immune responses to different serotype variants to guide adjuvant selection

• Delivery system optimization:

  • Testing how different vaccine platforms (protein subunit, live attenuated, DNA vaccines) perform across serotypes

  • Evaluating mucosal immune responses to recombinant antigens from different serotypes

  • Assessing cross-protection potential using mouse models of infection

• Methodological standardization:

  • Developing standardized challenge models applicable across serotypes

  • Creating consistent immunological assays to compare vaccine efficacy between serotypes

  • Establishing correlates of protection that apply across the Shigella genus