Recombinant Shigella boydii serotype 4 Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Expression

MsbA is an ATP-binding cassette (ABC) transporter critical for flipping lipid A-core molecules across bacterial inner membranes. In Shigella species, recombinant MsbA proteins are typically expressed in E. coli with an N-terminal His-tag for purification. Key characteristics include:

PropertyValueSource
Protein Length~580–600 amino acids (full-length)
Molecular Weight~64–67 kDa (estimated from primary sequence)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for storage

Functional Role in Lipid A Export

MsbA facilitates the translocation of lipid A-core molecules from the inner to outer leaflet of the inner membrane, a step essential for lipopolysaccharide (LPS) biosynthesis. Structural studies in E. coli reveal:

  • ATP-Dependent Transport: MsbA binds ATP, undergoing conformational changes to flip lipid A across membranes .

  • Substrate Specificity: Prefers Kdo₂-lipid A (disaccharide-linked lipid A) as a substrate, enhancing ATPase activity .

  • Cross-Species Conservation: High sequence homology between Shigella MsbA and E. coli MsbA suggests conserved mechanisms .

Lipid A Transport Mechanism

MsbA operates as a “flippase,” transferring lipid A from the inner to outer membrane leaflet. In E. coli, MsbA mutants (e.g., A270T) block lipid export, causing inner membrane invaginations and growth inhibition .

Role in Pathogenesis

  • LPS Modification: MsbA’s activity is linked to polymyxin resistance in Salmonella via L-Ara4N lipid A modifications .

  • Immunogenic Potential: While MsbA itself is not a surface-exposed antigen, its role in LPS biogenesis makes it a target for antimicrobial strategies .

Comparative Analysis of MsbA Across Species

SpeciesUniProt IDProtein LengthKey Features
S. dysenteriae Serotype 1Q32E34582 aaFull-length His-tagged; expressed in E. coli; >90% purity .
S. sonneiQ3Z3K7582 aaHomologous to S. dysenteriae MsbA; similar expression/purification protocols .
Pseudomonas fluorescensQ4KJB2601 aaExtended C-terminal region; retains ATPase activity with Kdo₂-lipid A .

Limitations and Future Directions

  • Data Gaps: No direct structural or functional studies on S. boydii serotype 4 MsbA are available.

  • Opportunities:

    • Antibiotic Targeting: Inhibiting MsbA could disrupt LPS biogenesis, a novel antimicrobial strategy.

    • Vaccine Development: Epitope-based approaches (e.g., targeting MsbA’s NBDs) may enhance cross-species protection .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your specified tag.
Synonyms
msbA; SBO_2202; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
msbA
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of lipopolysaccharide (LPS). It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: sbo:SBO_2202

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its role in Gram-negative bacteria?

MsbA is an essential ATP-binding cassette (ABC) transporter involved in lipid A transport across the cytoplasmic membrane of Gram-negative bacteria . It functions primarily as a membrane-bound ATPase that facilitates the translocation of lipid A from the inner to the outer leaflet of the cytoplasmic membrane, serving as a crucial component in bacterial membrane biogenesis . The protein's essential nature is demonstrated by studies showing that depletion or loss of function of MsbA results in the accumulation of lipopolysaccharide (LPS) and phospholipids in the cytoplasmic membrane of Escherichia coli . This accumulation ultimately leads to toxicity and cell death, highlighting MsbA's critical role in maintaining bacterial membrane integrity and function . While MsbA is presumed to facilitate flip-flop of lipids in an ATP-dependent manner, it's worth noting that direct demonstration of this mechanism remains an active area of research, as some studies have indicated the process may be more complex than initially theorized .

How does the structure of MsbA contribute to its functional capabilities?

The functional architecture of MsbA features distinct binding domains that enable its dual role in lipid transport and drug efflux. Research using fluorescent probe labeling has revealed that MsbA contains two substrate-binding sites that communicate with both the nucleotide-binding domain and with each other . The first is a high-affinity binding site specifically for lipid A, its physiological substrate, while the second site interacts with various drugs with comparable affinity . Structural studies have demonstrated that the protein can be labeled stoichiometrically with fluorescent probes such as MIANS on C315, which is located within the intracellular domain connecting transmembrane helix 6 and the nucleotide-binding domain . This strategic location allows researchers to monitor conformational changes during substrate binding and transport cycles . Importantly, experiments have shown that lipid A and amphipathic drugs like daunorubicin can bind to MsbA simultaneously, implying they occupy different binding sites within the protein structure . This architectural arrangement explains how MsbA can function as both a lipid flippase and a multidrug transporter, with substrate binding having additive effects rather than following a strictly ordered binding mechanism .

What genomic characteristics distinguish Shigella boydii serotype 4 MsbA from other Shigella species?

While specific genomic data for S. boydii serotype 4 MsbA is limited in the provided search results, comparative genomic analyses of Shigella species provide valuable context for understanding potential distinguishing features. The msbA gene is highly conserved across Gram-negative bacteria, but species-specific variations exist that may influence protein function and drug interactions . Within the broader Shigella genus, whole genome sequencing (WGS) and bioinformatic analysis have been instrumental in identifying species-specific genetic markers and antimicrobial resistance determinants . For instance, tools like Shigatyper, Mykrobe, and Resistance Gene Identifier (RGI) enable in silico serotyping and genotyping of different Shigella species, including identification of acquired antimicrobial resistance genes and point mutations . The genomic context of msbA in S. boydii likely influences its expression patterns and functional characteristics, particularly in relation to antimicrobial resistance mechanisms that may involve ABC transporters . Understanding these genomic distinctions is essential for researchers working with recombinant forms of the protein, as they may impact protein expression systems, purification strategies, and functional assays designed to characterize the recombinant protein's properties.

How does recombinant MsbA expression differ between expression systems, and what challenges exist in producing functional protein?

The expression of recombinant MsbA presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Different expression systems offer varying advantages and limitations that researchers must carefully consider. Bacterial expression systems like E. coli provide high yield but may result in inclusion body formation requiring refolding protocols that can compromise functionality . Yeast systems (e.g., Pichia pastoris) offer proper eukaryotic post-translational modifications but may produce glycosylation patterns that differ from the native bacterial environment . Insect cell systems strike a balance between yield and proper folding but require more complex cultivation conditions . Mammalian cell expression systems offer advanced folding machinery but typically provide lower yields at higher costs . A critical consideration for functional studies is maintaining the native lipid environment during purification, as MsbA's ATPase activity and substrate binding capabilities are highly dependent on the surrounding membrane composition . Research has shown that purified wild-type MsbA can be functionally labeled with fluorescent probes like MIANS while retaining high ATPase activity and proper folding, suggesting that careful optimization of expression and purification conditions can yield functional recombinant protein suitable for detailed biochemical and structural studies .

How do mutations in recombinant MsbA affect lipid A transport and drug efflux capabilities?

Mutations in recombinant MsbA can profoundly impact both lipid A transport and drug efflux functions, providing valuable insights into structure-function relationships and potential targets for therapeutic intervention. Site-directed mutagenesis studies focusing on the key residues within the transmembrane domains and nucleotide-binding domains have revealed critical regions for substrate recognition and transport . Mutations in the lipid A binding site typically result in reduced lipid A transport without necessarily affecting drug binding, while alterations in the drug-binding pocket can selectively impact drug efflux while preserving essential lipid A transport . Particularly informative are mutations affecting residues at the interface between the two binding sites, which can alter communication between these domains and potentially affect the binding affinity for both substrates . Research has shown that the binding affinity of MsbA for lipid A can be substantially decreased when the drug binding site is occupied first, and prior binding of nucleotide can modulate lipid A binding affinity, illustrating the complex allosteric interactions within the protein . These observations suggest that mutations affecting these interactions could have far-reaching effects on transport function . Understanding the consequences of specific mutations on transport function is crucial for designing inhibitors that might selectively target drug efflux without disrupting the essential lipid A transport function, potentially offering new approaches to combat antimicrobial resistance .

What techniques are most effective for assessing MsbA transport activity in vitro?

Assessing MsbA transport activity in vitro requires specialized methodologies that accurately capture both ATP hydrolysis and substrate translocation. The gold standard approach combines ATPase activity assays with direct substrate transport measurements . For ATPase activity, researchers typically employ colorimetric phosphate release assays using malachite green or radioactive ATP hydrolysis assays, which have successfully demonstrated that purified MsbA-MIANS displays high ATPase activity comparable to the wild-type protein . Substrate binding can be monitored through fluorescence-based approaches, where the fluorescence of MsbA-MIANS is saturably quenched by nucleotides, lipid A, and various drugs, allowing for estimation of binding affinity (Kd values typically ranging from 0.35–10 μM) . For direct measurement of lipid A transport, reconstitution of purified MsbA into proteoliposomes containing fluorescently labeled lipid A analogs allows researchers to monitor ATP-dependent translocation across the membrane bilayer . Alternative techniques include surface plasmon resonance (SPR) for real-time binding kinetics and isothermal titration calorimetry (ITC) for thermodynamic parameters of substrate binding . These complementary approaches have revealed important functional characteristics, including the presence of separate binding sites for lipid A and drugs, and the additive effects of nucleotide and substrate binding, providing a comprehensive picture of MsbA's transport mechanism .

How can genomic and proteomic approaches be integrated to study MsbA-mediated resistance mechanisms?

Integrating genomic and proteomic approaches offers a powerful strategy for elucidating MsbA-mediated resistance mechanisms in Shigella species. At the genomic level, whole-genome sequencing (WGS) using both short-read (Illumina) and long-read (Oxford Nanopore) technologies provides comprehensive genetic information about msbA variants and co-occurring resistance determinants . Bioinformatic tools such as Trimmomatic, Unicycler, and SPAdes can be employed for raw-read trimming and de novo genome assembly, while specialized software like Shigatyper, Mykrobe, and Resistance Gene Identifier (RGI) enable identification of species-specific markers and resistance genes . Phylogenetic analysis using maximum-likelihood approaches with tools like Snippy, Gubbins, and IQ-Tree helps contextualize MsbA variants within evolutionary frameworks . At the proteomic level, mass spectrometry-based approaches can identify post-translational modifications, protein-protein interactions, and expression-level changes in MsbA under various selective pressures . Particularly valuable are techniques like SWATH-MS (Sequential Window Acquisition of all Theoretical Mass Spectra) that provide both identification and quantification of proteins across different conditions . Integration of these datasets can be achieved through correlation analysis between genetic variants in msbA and corresponding proteomic signatures, potentially revealing how specific mutations impact protein expression, stability, or function . This multi-omics approach has proven successful in characterizing resistance mechanisms in Shigella outbreaks, as demonstrated by studies tracking the dissemination of extended-spectrum β-lactamase (ESBL)-producing isolates among specific population groups .

What experimental design best elucidates the interaction between MsbA and antimicrobial compounds?

Designing experiments to elucidate MsbA-antimicrobial compound interactions requires a multifaceted approach combining biophysical, biochemical, and microbiological techniques. Fluorescence-based binding assays using MsbA labeled with environment-sensitive probes like MIANS have successfully demonstrated that amphipathic drugs alter protein conformation and can bind to MsbA with affinities in the micromolar range (Kd values from 0.35–10 μM) . These assays can be complemented with competition experiments to determine if different antimicrobial compounds share binding sites . Evidence from such studies has shown that lipid A and daunorubicin can bind simultaneously to MsbA, implying they occupy different binding sites, which has important implications for understanding drug-transport mechanisms . Functional transport assays using inverted membrane vesicles or reconstituted proteoliposomes can directly measure drug efflux in the presence of ATP, providing insights into the kinetics and substrate specificity of transport . Structure-based approaches, including crystallography or cryo-electron microscopy of MsbA-drug complexes, can reveal atomic-level details of binding interactions . Microbiological assays correlating MsbA expression levels with minimum inhibitory concentrations (MICs) for various antibiotics help establish clinical relevance, as exemplified by studies using epidemiological cut-off values (ECVs) to define resistance breakpoints in Shigella species (e.g., zone-diameter ≤ 15 mm for S. flexneri and ≤ 11 mm for S. sonnei for azithromycin) . Finally, site-directed mutagenesis studies targeting residues predicted to be involved in drug binding can confirm the molecular basis of transport and provide potential targets for inhibitor design .

How should researchers interpret contradictory findings regarding MsbA substrate specificity?

Interpreting contradictory findings regarding MsbA substrate specificity requires careful consideration of experimental conditions, protein source variations, and methodological differences across studies. The current literature presents an apparent dichotomy regarding MsbA's substrate specificity—some studies suggest high specificity for lipid A transport, while others demonstrate broader specificity including various amphipathic drugs . These contradictions likely stem from several factors that researchers must systematically evaluate. First, differences in protein preparation methods can significantly impact functional properties; detergent-solubilized MsbA may exhibit different substrate preferences compared to membrane-embedded or reconstituted protein . Second, the lipid environment surrounding MsbA critically influences its conformation and activity, with studies showing that binding affinity for lipid A is substantially altered when the drug binding site is occupied first, suggesting complex allosteric interactions . Third, variations in nucleotide concentrations and the presence of co-factors across experimental setups can modify transport kinetics and apparent substrate preferences . Fourth, species-specific variations in MsbA sequence might contribute to functional differences, particularly given the evidence for rapid evolution of antimicrobial resistance mechanisms in Shigella species . To reconcile contradictory findings, researchers should design experiments that directly compare substrate binding and transport under identical conditions, ideally using the same protein preparation method and experimental system . Additionally, combining multiple complementary techniques—such as ATPase assays, fluorescence-based binding studies, and direct transport measurements—provides a more comprehensive picture of substrate specificity than any single approach .

What statistical approaches are most appropriate for analyzing MsbA-mediated resistance patterns in clinical isolates?

Analyzing MsbA-mediated resistance patterns in clinical isolates requires robust statistical frameworks that account for both genetic and phenotypic variables across diverse populations. Multivariate analyses, including principal component analysis (PCA) and hierarchical clustering, have proven effective in identifying patterns of co-resistance and distinguishing MsbA-specific effects from other resistance mechanisms . Longitudinal trend analyses using time-series statistical methods are essential for tracking temporal changes in resistance patterns, as demonstrated by studies showing increasing azithromycin resistance in Shigella from 22% to approximately 60% between 2009 and 2016 . Phylogenetic comparative methods that incorporate evolutionary relationships between isolates help distinguish convergent evolution of resistance from direct transmission events, with maximum-likelihood phylogeny approaches using tools like Snippy and Gubbins being particularly valuable for removing recombination events that might confound analysis . Regression modeling that includes both genomic predictors (presence of specific MsbA variants or mutations) and phenotypic outcomes (minimum inhibitory concentrations) can quantify the contribution of MsbA to observed resistance patterns . Population-specific analyses may be necessary given evidence for distinct resistance patterns in different risk groups, as illustrated by studies showing the dissemination of extended-spectrum β-lactamase (ESBL)-producing Shigella among men who have sex with men (MSM) . Finally, meta-analytical approaches that synthesize data across multiple studies and geographic regions provide the broadest perspective on MsbA-mediated resistance trends, though researchers must carefully account for methodological differences when comparing epidemiological cut-off values (ECVs) and resistance breakpoints established in different studies .

Statistical ApproachApplication in MsbA ResearchSoftware/ToolsKey Advantages
Multivariate AnalysisIdentifying co-resistance patternsR (FactoMineR, vegan), Python (scikit-learn)Reveals complex relationships between multiple resistance determinants
Longitudinal Trend AnalysisTracking temporal changes in resistanceR (forecast, nlme), SPSSIdentifies emerging resistance trends over time
Phylogenetic Comparative MethodsDistinguishing convergent evolution from transmissionSnippy, Gubbins, IQ-TreeAccounts for evolutionary relationships between isolates
Regression ModelingQuantifying MsbA contribution to resistanceR (lme4), STATAProvides statistical significance and effect sizes
Population-Specific AnalysisIdentifying risk-group specific patternsR (survey), SASReveals targeted intervention opportunities
Meta-AnalysisSynthesizing data across studiesR (metafor), RevManIncreases statistical power and generalizability

How can researchers distinguish between MsbA-mediated effects and other resistance mechanisms in Shigella?

Distinguishing MsbA-mediated effects from other resistance mechanisms in Shigella requires a comprehensive experimental approach that isolates specific transport functions while accounting for the complex interplay of multiple resistance determinants. Genetic modification approaches, particularly gene deletion and complementation studies, provide the most direct evidence for MsbA-specific contributions to resistance . Since complete deletion of msbA is typically lethal due to its essential role in lipid A transport, conditional expression systems using inducible promoters allow for controlled modulation of MsbA levels and subsequent assessment of antimicrobial susceptibility patterns . Site-directed mutagenesis targeting specific functional domains—separating lipid A transport from drug efflux capabilities—can help researchers isolate MsbA's contribution to drug resistance from its essential cellular functions . Comparative genomic analysis between resistant and susceptible isolates should focus not only on the msbA gene itself but also on co-occurring resistance determinants, as studies have identified specific plasmids that simultaneously encode resistance to multiple antibiotic classes, including third-generation cephalosporins, macrolides, sulfonamides, trimethoprim, and aminoglycosides . Phenotypic approaches using specific inhibitors of different resistance mechanisms in combination with MsbA modulators can help partition resistance contributions, while transport assays with fluorescently labeled substrates in membrane vesicles provide direct evidence of MsbA-mediated efflux . Resistance patterns across antibiotic classes can also provide clues, as MsbA-mediated resistance would primarily affect amphipathic drugs, whereas other mechanisms like the mphA gene specifically confer macrolide resistance in Shigella . The integration of these approaches allows researchers to quantify MsbA's specific contribution to the increasingly complex resistance profiles observed in clinical isolates, such as the extensively drug-resistant (XDR) S. sonnei strains that have emerged in recent years .

What novel approaches might enhance inhibition of MsbA as a strategy for overcoming multidrug resistance?

Developing novel approaches to inhibit MsbA represents a promising frontier in combating multidrug resistance in Shigella and other Gram-negative pathogens. Structure-guided drug design targeting the unique features of MsbA offers several promising avenues . Allosteric inhibitors that exploit the communication between MsbA's two substrate-binding sites could potentially disrupt drug efflux while preserving essential lipid A transport, addressing a key challenge in developing clinically viable inhibitors . Research showing that binding affinity for lipid A is substantially altered when the drug binding site is occupied suggests that designed molecules occupying specific binding pockets could modulate transport function in therapeutically beneficial ways . Peptide-based inhibitors derived from transmembrane sequences of MsbA itself might disrupt oligomerization or conformational changes required for transport activity . Nucleotide-binding domain targeted approaches that interfere with ATP binding or hydrolysis without affecting other essential ABC transporters would provide selective inhibition . Combination approaches targeting both MsbA and other resistance determinants, such as the mphA gene that confers macrolide resistance, could provide synergistic effects, particularly given the evidence that multiple resistance determinants are often co-located on mobile genetic elements like the 63MDa conjugative plasmid identified in Shigella . Finally, targeting the regulatory elements controlling msbA expression might offer an indirect approach to modulating its contribution to resistance without completely eliminating its essential cellular functions . These diverse strategies highlight the need for multidisciplinary approaches combining structural biology, medicinal chemistry, and microbial genetics to develop clinically viable MsbA inhibitors capable of overcoming the increasing antimicrobial resistance observed in Shigella species worldwide .

How might techniques from structural biology advance our understanding of MsbA conformational changes during transport?

Advanced structural biology techniques offer unprecedented opportunities to visualize and understand the dynamic conformational changes in MsbA during transport cycles, potentially revealing new targets for inhibitor design. Time-resolved cryo-electron microscopy (cryo-EM) represents a revolutionary approach that could capture MsbA in various conformational states throughout the transport cycle, providing snapshots of substrate binding, ATP hydrolysis, and release events . Single-molecule Förster resonance energy transfer (smFRET) experiments, building upon existing fluorescence-based approaches with MsbA-MIANS, can track real-time conformational changes in individual protein molecules, revealing heterogeneity and transient intermediates not detectable in ensemble measurements . Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers complementary information on protein dynamics and solvent accessibility changes during transport, potentially identifying regions that undergo significant structural rearrangements . Molecular dynamics simulations incorporating structures of MsbA in different conformational states can model the complete transport cycle in atomic detail, providing insights into energy barriers and rate-limiting steps . Cross-linking mass spectrometry (XL-MS) combined with computational modeling can reveal distance constraints between specific residues during different conformational states . Solid-state nuclear magnetic resonance (ssNMR) studies of MsbA in native-like lipid environments can provide atomic-level details of lipid-protein interactions that may regulate transport function . These emerging approaches, especially when applied to recombinant S. boydii MsbA, would significantly advance our understanding of the molecular mechanisms underlying dual substrate specificity and allosteric communication between binding sites, potentially revealing species-specific features that could be exploited in targeted inhibitor design strategies .

What is the potential impact of combining genomic surveillance of msbA variants with clinical antimicrobial susceptibility testing?

Integrating genomic surveillance of msbA variants with clinical antimicrobial susceptibility testing creates a powerful framework for predicting and managing antimicrobial resistance in Shigella infections. This combined approach enables the identification of emerging resistance-associated variants before they become clinically problematic . Whole genome sequencing (WGS) of clinical isolates, particularly using the combination of short-read and long-read sequencing technologies demonstrated in Shigella outbreak investigations, provides comprehensive genetic information about msbA variations and co-occurring resistance determinants . Machine learning algorithms trained on combined genomic-phenotypic datasets can predict minimum inhibitory concentrations (MICs) from sequence data alone, potentially accelerating resistance detection in clinical settings . Population-level surveillance can identify risk group-specific patterns, as exemplified by studies tracking the international transmission of extensively drug-resistant (XDR) Shigella sonnei among men who have sex with men (MSM), allowing for targeted intervention strategies . Temporal tracking of msbA variants alongside clinical resistance patterns can elucidate evolutionary trajectories and predict future resistance trends, similar to the documented increase in azithromycin resistance in Shigella from 22% to approximately 60% between 2009 and 2016 . Molecular epidemiology approaches integrating phylogenetic analysis with geographic and demographic data can trace the dissemination of resistance-associated MsbA variants across populations and borders, as demonstrated by studies showing that XDR ESBL-producing CipR.MSM5 S. sonnei isolates from Barcelona were genetically closer to isolates from the UK and Australia than to local non-ESBL-producing strains . The practical implementation of this integrated approach would support evidence-based antimicrobial stewardship programs, guide empiric therapy decisions in different geographic regions, and potentially inform the development of novel diagnostics targeting specific msbA variants associated with treatment failure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.