Recombinant Shigella boydii serotype 4 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Biological Role in Shigella

YidC is essential for bacterial survival and pathogenesis:

  • Membrane Protein Biogenesis: Catalyzes the integration of hydrophobic regions of membrane proteins into the lipid bilayer, acting independently or alongside the Sec translocase .

  • Virulence Regulation: Required for polar localization of the autotransporter IcsA, a critical virulence factor enabling actin-based motility during infection .

  • Pathogen Adaptation: Facilitates responses to environmental stressors like bile salts, which enhance T3SS effector secretion .

Functional Studies

  • Depletion of YidC disrupts membrane protein localization, impairing bacterial growth and virulence .

  • In vitro reconstitution demonstrates YidC alone can insert model substrates (e.g., Pf3 coat protein) into liposomes, confirming its enzymatic role .

Therapeutic Potential

  • Antisense RNA-mediated yidC downregulation sensitizes E. coli to essential oils (eugenol, carvacrol), highlighting YidC as a drug target .

  • Recombinant YidC is under investigation as a vaccine antigen due to its surface exposure and role in pathogenesis .

Comparative Analysis with Homologs

YidC is conserved across bacteria, but Shigella variants exhibit unique adaptations:

SpeciesRoleKey Difference
E. coli YidCInserts Sec-independent proteins Stable interaction with SecYEG translocase .
S. flexneri YidBUnknown function; distinct structural foldNo homology to YidC .
Mitochondrial Oxa1Evolutionary homologInvolved in respiratory chain assembly .

Applications and Challenges

  • Vaccine Development: Recombinant YidC is used in preclinical studies to elicit immune responses against Shigella .

  • Antibiotic Adjuvants: Synergy between YidC inhibition and natural antimicrobials suggests combinatorial therapeutic strategies .

  • Technical Hurdles: Structural flexibility and membrane-associated nature complicate crystallization and in vitro studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; SBO_3671; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKTQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
YidC is crucial for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins, both dependent and independent of the Sec translocase complex, as well as in the incorporation of some lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links

KEGG: sbo:SBO_3671

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of YidC and how does it relate to function?

YidC possesses a distinctive arrangement of five conserved transmembrane domains (TM2-TM6) with a helical hairpin between TM2 and TM3 positioned on the cytoplasmic membrane surface. This structural arrangement is critical for its insertase activity . The protein contains both a rigid transmembrane core and more flexible polar loop regions that "swim" on the membrane surface, as demonstrated by molecular dynamics simulations .

Functionally important structural features include:

Structural ElementLocationFunctional Significance
Transmembrane coreTM2-TM6Provides structural stability
Helical hairpinBetween TM2-TM3Important for cytoplasmic interactions
Hydrophilic grooveCytoplasmic side of TM bundlePotential substrate binding site
Periplasmic P1 domainPeriplasmic regionShows flexibility relative to membrane region

How does Shigella boydii YidC compare with YidC from other bacterial species?

The Shigella boydii serotype 4 YidC consists of 548 amino acids and shares high sequence homology with Escherichia coli YidC . When designing comparative studies, researchers should focus on the five conserved transmembrane domains rather than the variable N-terminal regions. The amino acid sequence of Shigella boydii YidC contains characteristic hydrophobic transmembrane segments interspersed with charged residues that facilitate interactions with substrate proteins .

To effectively compare YidC homologs across species:

  • Generate multiple sequence alignments excluding the non-conserved first transmembrane helix (TM1) and P1 domain

  • Calculate evolutionary coupling strengths between residue pairs

  • Identify conserved residue contacts that maintain the core structure

  • Map species-specific variations to understand functional adaptations

What expression systems are optimal for recombinant Shigella boydii YidC production?

The recombinant production of membrane proteins like YidC presents significant challenges. Based on available research, E. coli expression systems have been successfully used for Shigella boydii YidC production . When designing expression protocols, researchers should consider:

  • Utilizing low-temperature induction (16-25°C) to reduce inclusion body formation

  • Employing weak promoters or carefully controlled expression to prevent toxicity

  • Including fusion tags like His-tags for purification while minimizing structural interference

  • Testing multiple detergents for optimal solubilization while maintaining protein function

Expression optimization parameters include:

ParameterRecommended ApproachRationale
Host strainC41(DE3) or C43(DE3)Engineered for membrane protein overexpression
Growth temperature18-25°C post-inductionSlows expression rate, improves folding
Inducer concentration0.1-0.5 mM IPTGModerate induction reduces toxicity
Harvest timing4-6 hours post-inductionBalances yield and protein quality

What approaches are most effective for studying YidC-substrate interactions?

To investigate YidC-substrate interactions, several complementary approaches have proven effective:

  • Proximity-dependent biotin labeling (BioID): This technique has successfully identified YibN as a crucial component within the YidC protein environment . The method involves fusing a biotin ligase to YidC, allowing biotinylation of proximal proteins which can then be isolated and identified.

  • Disulfide crosslinking: By introducing cysteine residues at specific positions in both YidC and substrate proteins, researchers can capture transient interactions. This approach confirmed that the TM domain of the nascent F0c chain interacts with TM3 of YidC rather than TM5 . The protocol involves:

    • Creating single cysteine mutants in both YidC and the substrate protein

    • Reconstituting the components in vitro

    • Exposing to oxidizing agents like 5,5'-dithiobis-(2-nitrobenzoicacid) (DTNB)

    • Analyzing crosslinked products by SDS-PAGE and immunoblotting

  • Co-expression assays: YidC substrates such as M13 procoat, Pf3 coat proteins, and F0c can be co-expressed with YidC to assess insertion efficiency . For optimal results:

    • Use room temperature expression

    • Apply 0.1% arabinose for 15 minutes to induce YidC expression

    • Add 0.75 mM IPTG to induce substrate synthesis

    • Compare insertion efficiency with and without YidC overexpression

How can researchers assess the essentiality and function of specific YidC residues?

Identifying functionally critical residues in YidC requires systematic mutagenesis coupled with complementation assays. The following methodological approach has proven effective:

  • Alanine-scanning mutagenesis: Replace individual residues with alanine to eliminate side chain interactions while maintaining backbone structure. Key residues identified in previous studies include T362 in TM2 and Y517 in TM6, which completely inactivated YidC when mutated to alanine .

  • In vivo complementation assay: This approach allows researchers to determine if mutant YidC variants can support bacterial growth when the chromosomal yidC gene is depleted. The protocol involves:

    • Constructing a strain where chromosomal yidC expression is under control of an inducible promoter

    • Transforming the strain with plasmids expressing mutant YidC variants

    • Growing cultures with and without inducer

    • Measuring growth rates to assess complementation efficiency

  • Protein stability assessment: To distinguish between functional defects and protein instability, mutant YidC expression levels should be verified by immunoblotting .

PositionRegionMutationEffect on FunctionProtein Stability
T362TM2AlanineComplete inactivationStable
Y517TM6AlanineComplete inactivationStable
Y370Cytoplasmic regionAlanineSevere interferenceStable
Y377Cytoplasmic regionAlanineSevere interferenceStable
D488Cytoplasmic regionLysineSevere interferenceStable

What techniques are available for studying YidC-ribosome interactions during co-translational insertion?

Co-translational membrane protein insertion via YidC involves direct interactions with the ribosome. Researchers can investigate these interactions using:

  • Cryo-electron microscopy (cryo-EM): This technique has successfully visualized YidC-ribosome complexes, revealing how a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit . The methodology involves:

    • Preparing ribosome-nascent chain complexes (RNCs) carrying YidC substrates

    • Reconstituting these RNCs with purified YidC

    • Vitrifying samples and collecting cryo-EM data

    • Processing images to generate 3D reconstructions

    • Docking molecular models into the electron density

  • Mutational analysis of ribosome-binding residues: Residues Y370, Y377 (which contact ribosomal RNA helix 59), and D488 (which contacts ribosomal protein uL23) have been identified as critical for YidC-ribosome interaction . Researchers can design similar studies to identify additional contact points.

  • Ribosome profiling: This genome-wide approach can identify transcripts that are being translated by ribosomes associated with YidC, providing insights into the complete substrate spectrum.

How can antisense RNA technology be applied to study YidC function and identify potential inhibitors?

Antisense RNA-mediated gene silencing offers a powerful approach for studying essential proteins like YidC. Researchers have successfully used this technique to downregulate yidC expression in Escherichia coli, resulting in impaired bacterial growth . This methodology can be adapted for Shigella boydii YidC research as follows:

  • Design of antisense RNA constructs:

    • Target regions with high accessibility (avoid structured regions)

    • Design complementary sequences of 100-200 nucleotides

    • Clone into inducible expression vectors (e.g., arabinose-inducible systems)

  • Assessment of YidC depletion effects:

    • Monitor growth curves following antisense induction

    • Measure YidC protein levels by immunoblotting

    • Assess membrane protein insertion efficiency for known YidC substrates

  • Screening for YidC inhibitors:

    • Test compounds for synergistic activity with YidC depletion

    • Calculate Fractional Inhibitory Concentration Indices (FICIs)

    • Focus on natural compounds like essential oils (e.g., eugenol and carvacrol have shown synergy with YidC depletion in E. coli)

This approach provides rapid means to screen novel potential YidC inhibitors, an important consideration given that there are currently no known specific YidC inhibitors in the literature .

What is the significance of the YidC-YibN interaction and how can researchers investigate it further?

Recent research using proximity-dependent biotin labeling (BioID) has identified YibN as an important interactor of YidC . This discovery opens new avenues for understanding YidC function and regulation. To investigate this interaction further, researchers should consider:

  • Biochemical characterization of the interaction:

    • Co-immunoprecipitation with tagged variants of both proteins

    • Surface plasmon resonance to determine binding affinities

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional impact assessment:

    • Co-expression studies to determine if YibN enhances YidC activity

    • Deletion/overexpression studies to assess phenotypic effects

    • Substrate insertion assays in the presence/absence of YibN

  • Structural studies:

    • Cross-linking coupled with mass spectrometry to identify proximity

    • Cryo-EM of YidC-YibN complexes

    • Computational modeling of the complex

Initial studies have shown that YibN production is associated with membrane proliferation, circumvolutions, and multilayered structures primarily at the bacterial inner membrane . Additionally, YibN appears to augment the biogenesis of known YidC substrates including M13 procoat, Pf3 coat proteins, and F0c . These findings suggest YibN may function as a modulator of YidC activity, potentially enhancing its insertase function.

How can evolutionary co-variation analysis advance our understanding of YidC structure and function?

Evolutionary co-variation analysis has proven valuable in developing structural models of YidC . This computational approach identifies pairs of residues that have co-evolved, suggesting spatial proximity in the folded protein. Researchers can apply this methodology by:

  • Constructing comprehensive multiple sequence alignments:

    • Collect YidC homologs across diverse bacterial species

    • Exclude non-conserved regions (e.g., TM1 and P1 domain in E. coli YidC)

    • Align sequences using programs optimized for membrane proteins

  • Computing direct evolutionary couplings:

    • Use algorithms like EVcouplings or GREMLIN to calculate coupling strengths

    • Identify diagonal and anti-diagonal patterns indicative of helix-helix interactions

    • Aggregate evidence to compute interaction probabilities

  • Validating predicted contacts experimentally:

    • Design cysteine pairs based on predicted contacts

    • Perform disulfide crosslinking experiments

    • Use complementation assays to assess functional significance

  • Building and refining structural models:

    • Use predicted contacts as constraints in molecular modeling

    • Validate models with molecular dynamics simulations

    • Assess stability and biochemical properties in simulated membrane environments

This approach successfully identified seven helix-helix contacts with probabilities above 57% in YidC, while all other possible contacts scored below 15%, demonstrating the specificity of the method .

What evidence supports YidC as a viable antibacterial target?

YidC represents a promising antibacterial target for several compelling reasons:

  • Essentiality: YidC is highly conserved among bacterial pathogens and is essential for membrane protein insertion, making it critical for bacterial survival .

  • Experimental validation: RNA silencing of yidC in E. coli resulted in impaired bacterial growth, confirming that reduction of YidC synthesis leads to growth retardation .

  • Synergistic effects: YidC depletion sensitizes bacteria to certain antibacterial compounds. For instance, yidC antisense expression in E. coli resulted in sensitization to the essential oils eugenol and carvacrol, with Fractional Inhibitory Concentration Indices (FICIs) indicating high levels of synergy .

  • Divergence from eukaryotic homologs: While eukaryotes possess YidC homologs (Oxa1 in mitochondria and Alb3 in chloroplasts), they show sufficient structural differences that could potentially be exploited for selective targeting.

When developing YidC-targeted antibacterial strategies, researchers should focus on compounds that either directly inhibit YidC function or show synergy with YidC depletion. The antisense RNA approach described in the literature provides a valuable screening platform for identifying such compounds .

What methodological approaches are recommended for developing YidC inhibitors?

To develop effective inhibitors of Shigella boydii YidC, researchers should consider a multi-faceted approach:

  • Structure-based drug design:

    • Use available structural models of YidC to identify potential binding pockets

    • Focus on regions critical for function (e.g., hydrophilic groove, ribosome-binding interface)

    • Employ virtual screening to identify lead compounds

    • Refine candidates through iterative optimization

  • High-throughput screening platforms:

    • Develop assays that measure YidC-mediated membrane protein insertion

    • Screen compound libraries for insertion inhibition

    • Follow up with secondary assays to confirm specificity

  • Antisense RNA-based sensitization:

    • Use partial depletion of YidC via antisense expression

    • Screen for compounds with enhanced activity against YidC-depleted bacteria

    • Calculate FICIs to quantify synergy levels

  • Target validation studies:

    • Confirm that candidate compounds bind directly to YidC

    • Verify specificity by testing effects on YidC mutants

    • Assess impact on known YidC substrates

This combinatorial approach maximizes the chances of identifying effective inhibitors by addressing both direct inhibition of YidC and synergistic effects that could lead to lower effective doses.

What are the optimal storage and handling conditions for recombinant Shigella boydii YidC?

Proper storage and handling of recombinant YidC is critical for maintaining its structural integrity and functional activity. Based on available information, researchers should follow these guidelines:

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot the protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

  • Buffer considerations:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been shown to be effective

    • When changing buffers, use gradual dialysis to prevent protein denaturation

  • Quality assessment:

    • Verify protein integrity by SDS-PAGE before use

    • Assess activity through functional assays specific to YidC

Following these recommendations will help ensure that experimental outcomes are not compromised by protein degradation or denaturation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.