Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoA; SBO_2321; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.
Database Links

KEGG: sbo:SBO_2321

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in Shigella boydii?

NADH-quinone oxidoreductase subunit A (nuoA) is a small membrane-spanning protein that forms part of the respiratory chain complex I (NADH:quinone oxidoreductase). Unlike other complex I core protein subunits, NuoA has no known homologues in other enzyme systems, making it unique to this respiratory complex . In Shigella boydii, including serotype 4, nuoA contributes to the electron transport chain for energy generation during bacterial metabolism. The protein functions by helping transfer electrons from NADH to quinone, generating a proton gradient across the bacterial membrane that drives ATP synthesis.

How does the transmembrane orientation of nuoA affect its function?

The transmembrane orientation of nuoA is critical to its functionality in the respiratory chain. Research on Escherichia coli complex I has demonstrated that the C-terminal end of the nuoA polypeptide is localized in the bacterial cytoplasm, which contradicts earlier findings from studies of the homologous NQO7 subunit in Paracoccus denitrificans . This orientation is significant because it determines how nuoA interacts with other subunits of the complex and influences electron transfer efficiency. When designing experiments with recombinant Shigella boydii serotype 4 nuoA, researchers should consider this orientation to ensure proper protein folding and function in any expression system.

What expression systems are most effective for producing functional recombinant Shigella boydii serotype 4 nuoA?

For expression of recombinant Shigella boydii nuoA proteins, E. coli is often the preferred host system due to its genetic similarity to Shigella . When expressing membrane proteins like nuoA, researchers should consider using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3). For functional studies requiring post-translational modifications, alternative systems including yeast, baculovirus, or mammalian cell expression may be more appropriate . The choice between these systems should be guided by the research question, as each offers different advantages for protein yield, folding, and functionality.

What are the optimal purification strategies for obtaining high-purity recombinant nuoA protein?

Purification of recombinant nuoA from Shigella boydii presents challenges due to its transmembrane nature. A multi-step purification protocol is recommended, beginning with cell disruption using methods gentle enough to preserve protein structure (such as sonication with detergent). Immobilized metal affinity chromatography (IMAC) using histidine tags is often effective as an initial purification step. This should be followed by size exclusion chromatography to separate nuoA from contaminants of different molecular weights. For highest purity (>90%), ion exchange chromatography may be applied as a final step . Throughout the purification process, maintaining protein in a stabilizing buffer containing glycerol and appropriate detergents is crucial for preserving its native conformation.

How can researchers optimize transfection protocols when working with nuoA in mammalian expression systems?

When expressing bacterial proteins like nuoA in mammalian systems, optimizing transfection protocols is essential. Researchers can apply the Design of Transfections (DoT) methodology, which uses design of experiments (DoE) principles to systematically identify optimal transfection conditions . For nuoA expression, key parameters to optimize include: transfection reagent type (with polyethyleneimine/PEI being cost-effective), reagent concentration, DNA concentration, and cell density. The optimization process should begin with a two-level factorial design to identify significant factors, followed by response surface methodology to determine optimal conditions.

What techniques are most effective for determining the membrane topology of nuoA in Shigella boydii serotype 4?

To accurately determine the membrane topology of nuoA in Shigella boydii, researchers should employ complementary approaches. Fusion protein techniques, similar to those used with E. coli nuoA, where the protein is expressed as fusion constructs with reporter proteins like cytochrome c or alkaline phosphatase, can reveal the orientation of protein termini . These reporters exhibit differential activity depending on whether they are located in the cytoplasm or periplasm, thereby indicating the orientation of the attached nuoA terminus.

Additional techniques should include cysteine scanning mutagenesis coupled with accessibility assays, where strategically placed cysteine residues are probed for accessibility to membrane-impermeable reagents. Complementary computational approaches using hydropathy analysis and transmembrane prediction algorithms can provide theoretical models to guide experimental design. For highest confidence results, researchers should compare findings across multiple methods, as was done in revising the understanding of nuoA orientation in E. coli, where experimental evidence contradicted previous models .

How can researchers distinguish between functional and non-functional conformations of recombinant nuoA?

Distinguishing functional from non-functional conformations of recombinant nuoA requires a multi-faceted approach combining structural and functional analyses. Activity assays measuring NADH dehydrogenase function in reconstituted systems provide direct evidence of functionality. Circular dichroism (CD) spectroscopy can assess secondary structure integrity, while limited proteolysis can identify properly folded domains through their resistance to digestion.

For more detailed structural information, researchers should consider native mass spectrometry to verify correct subunit assembly within complex I. Comparative analysis between recombinant nuoA and the native protein purified from Shigella boydii serotype 4 can reveal structural discrepancies. When designing these experiments, researchers should include appropriate controls and consider that functional nuoA likely requires proper integration into the membrane and correct interaction with other complex I subunits to maintain its native conformation.

What assays are available for measuring the electron transport activity of recombinant nuoA within complex I?

Measuring electron transport activity of recombinant nuoA requires assays that can assess its contribution to complex I function. Standard enzymatic assays include spectrophotometric measurement of NADH oxidation rate at 340 nm, which directly correlates with complex I activity. For specific evaluation of nuoA's role, researchers should compare activity between wild-type complex I and variants with mutated nuoA.

Oxygen consumption measurements using oxygen electrodes provide real-time analysis of respiratory chain function in membrane preparations or whole cells expressing recombinant nuoA. For more precise mechanistic studies, researchers can use artificial electron acceptors like ferricyanide to bypass portions of the electron transport chain. Advanced techniques such as potentiometric titrations can determine midpoint potentials of electron carriers associated with nuoA function. When interpreting results, researchers should consider that nuoA functions as part of a larger complex, so its individual contribution may be difficult to isolate without carefully designed control experiments.

How can researchers assess the impact of nuoA mutations on Shigella boydii virulence?

Assessing the impact of nuoA mutations on Shigella boydii virulence requires multiple experimental approaches. In vitro invasion assays using epithelial cell lines can measure the ability of nuoA-mutant Shigella to invade host cells compared to wild-type bacteria. Complementation studies, where mutant strains are transformed with plasmids expressing wild-type nuoA, can confirm phenotype specificity.

For in vivo assessment, the recently developed NAIP-NLRC4-deficient mouse model offers particular advantages, as these mice recapitulate clinical features of human shigellosis . When designing such experiments, researchers should include measurements of bacterial burden in tissues, histopathological evaluation of intestinal lesions, and quantification of inflammatory responses. A comprehensive approach would also include transcriptomic analysis of host responses to wild-type versus nuoA-mutant Shigella to identify pathways affected by this protein. These experiments should control for potential polar effects of nuoA mutations on downstream genes in the same operon.

What evolutionary insights can be gained from comparing nuoA sequences across different Shigella boydii serotypes?

Evolutionary analysis of nuoA across Shigella boydii serotypes can reveal important insights into bacterial adaptation. Researchers should construct phylogenetic trees using nuoA sequences from multiple serotypes, including the recently recognized serotypes 16, 17, and 18 , to identify evolutionary relationships. Calculation of synonymous versus non-synonymous substitution rates (dN/dS) can indicate whether nuoA is under purifying or diversifying selection.

Of particular interest would be correlation analyses between nuoA sequence variations and serotype-specific ecological niches or virulence characteristics. Given that Shigella evolved from E. coli, comparative genomics extending to E. coli nuoA homologues can provide context for serotype diversification. For serotype 4 specifically, researchers should examine whether any sequence variations occur in functional domains that might impact respiratory efficiency or adaptation to host environments. These evolutionary analyses should be conducted using multiple sequence alignment tools and phylogenetic software with appropriate statistical validation.

How can recombinant nuoA be utilized in drug discovery targeting Shigella boydii infections?

Recombinant nuoA from Shigella boydii serotype 4 represents a potential target for antimicrobial development. Researchers can establish high-throughput screening assays using purified recombinant nuoA to identify compounds that specifically inhibit its function or integration into complex I. Structure-based drug design approaches, informed by crystallographic or cryo-EM data of nuoA, can guide the development of targeted inhibitors.

When developing these screening platforms, researchers should include counterscreens against human mitochondrial complex I to ensure selectivity. The unique properties of nuoA, which lacks homologues in other enzyme systems , make it a particularly promising target for specific inhibition. Validation of potential hits should progress from biochemical assays with purified protein to whole-cell assays measuring growth inhibition of Shigella boydii serotype 4, and finally to infection models. Throughout this process, researchers should monitor for the emergence of resistance mutations in nuoA to understand potential limitations of any therapeutic candidates.

What are the methodological considerations for using nuoA as a serotype-specific marker in Shigella boydii diagnostics?

Developing nuoA-based diagnostics for Shigella boydii serotype 4 requires careful consideration of its sequence specificity. Researchers should first perform comprehensive sequence analyses across all Shigella serotypes to identify regions unique to serotype 4. These regions can then be targeted for PCR primer design or antibody generation.

For nucleic acid-based detection, multiplex PCR or isothermal amplification methods targeting serotype-specific regions of nuoA can be developed. Validation should include specificity testing against other Shigella serotypes and related Enterobacteriaceae. For protein-based approaches, monoclonal antibodies recognizing serotype-specific epitopes of nuoA can be generated for use in ELISA or lateral flow assays. When designing these diagnostic tests, researchers should establish analytical performance characteristics including sensitivity, specificity, reproducibility, and limits of detection using clinical isolates. Additionally, researchers should consider the potential impact of sequence variations within serotype 4 isolates from different geographical regions on diagnostic performance.

How can researchers effectively organize and analyze complex data sets generated from nuoA studies?

Management of complex data from nuoA studies benefits from software engineering best practices similar to those used in data analytics pipelines . Researchers should implement standardized structured objects for data organization, including query declarations that describe transformation inputs and structured metadata that document dataset descriptions, column definitions, and quality parameters. This approach facilitates both automation and reproducibility.

Implementation of naming conventions for tables and metrics ensures consistency and facilitates data discovery across research teams. For experimental datasets related to nuoA, researchers should create frameworks that allow metrics to be defined once and reused across multiple analyses, reducing redundancy and potential errors . When managing nuoA sequence data, structural information, and functional assay results, a well-defined file organization structure makes code discovery easier and ensures appropriate access controls. This systematic approach to data management is particularly valuable for collaborative research on complex systems like respiratory chain components.

What statistical approaches are most appropriate for analyzing variations in nuoA function across experimental conditions?

Statistical analysis of nuoA functional data requires approaches that can account for multiple variables and potential interactions. Design of Experiments (DoE) methodologies, as applied in the Design of Transfections framework, provide robust approaches for systematically evaluating multiple factors . For initial screening of variables affecting nuoA function, researchers should implement full factorial designs to identify significant factors and their interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.