Recombinant Shigella boydii serotype 4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development if possible.
Synonyms
arnE; SBO_2294.1; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of the ArnE flippase subunit in Shigella boydii?

The ArnE flippase subunit in S. boydii functions as part of a membrane transport system responsible for flipping 4-amino-4-deoxy-L-arabinopyranose (Ara4N) residues across the bacterial membrane. This process is crucial for modifying the bacterial lipopolysaccharide (LPS) structure. Specifically, ArnE contributes to the transport of Ara4N-phosphoundecaprenol intermediates, which ultimately leads to the addition of Ara4N to lipid A components of LPS . This modification reduces the negative charge of the outer membrane, which has significant implications for bacterial survival under various stress conditions, particularly in the presence of certain antibiotics.

How does 4-amino-4-deoxy-L-arabinose modification contribute to antibiotic resistance?

The addition of 4-amino-4-deoxy-L-arabinopyranose (Ara4N) residues to bacterial lipopolysaccharide is directly linked to antibiotic resistance through charge modification. Ara4N residues reduce the negative charge in the lipid A and core regions of bacterial LPS, which decreases the binding affinity of cationic antimicrobial peptides and certain antibiotics . This modification essentially creates a more resistant outer membrane barrier that prevents antibiotic penetration. The ArnT transferase catalyzes the transfer of Ara4N onto lipid A, completing this resistance-conferring modification that protects the bacterium against antimicrobial compounds such as polymyxins and other cationic antimicrobial peptides.

What are the key structural components of the ArnE flippase system?

The ArnE flippase functions as a subunit of a larger membrane transport complex involved in lipid translocation. While complete structural details specific to S. boydii ArnE are not fully characterized in the provided materials, flippases generally belong to the P4 ATPase family of lipid transporters that facilitate asymmetric distribution of lipids across biological membranes . The ArnE subunit likely contains multiple transmembrane domains that create a pathway for the Ara4N-phosphoundecaprenol substrate to move across the membrane bilayer. The functionality of ArnE depends on its association with other components of the Arn pathway, including ArnF, which together form the complete flippase unit necessary for Ara4N transport.

How does the mechanism of ArnE-mediated flipping differ from other bacterial lipid flippases?

The ArnE-mediated flipping mechanism likely differs from other bacterial lipid flippases in substrate specificity and energy coupling. Unlike general phospholipid flippases that primarily transport common membrane phospholipids, ArnE specifically handles 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol, a specialized substrate in the LPS modification pathway . This specificity is critical for targeted antimicrobial resistance.

How does environmental adaptation influence the evolution of the arnE gene in Shigella boydii?

Environmental adaptation appears to drive significant evolutionary pressure on the arnE gene and related antibiotic resistance mechanisms in Shigella species. Historical genomic analyses reveal a wave-like pattern of resistance determinant acquisition over time, beginning with sulfonamide resistance in the 1950s, followed by streptomycin and tetracycline resistance in the 1960s, and β-lactamases emerging in the 1970s .

The evolutionary trajectory of arnE likely follows similar selective pressures, particularly in response to the clinical use of polymyxins and other cationic antimicrobials. Unlike some resistance genes that show evidence of being acquired and lost multiple times across different lineages , genes involved in fundamental LPS modifications may experience more consistent selection pressure due to their dual roles in both antibiotic resistance and general membrane integrity maintenance.

The geographic isolation observed in the spread of resistance determinants in S. flexneri suggests that arnE variants may also evolve with regional specificity . This contrasts with the global spread patterns seen in S. sonnei, indicating that different Shigella species may experience distinct evolutionary constraints on their LPS modification systems, potentially including the arnE gene.

What are the optimal methods for expressing recombinant ArnE in laboratory settings?

The optimal expression of recombinant ArnE in laboratory settings requires careful consideration of both the expression system and gene integration method. Based on successful approaches with related proteins, genomic integration rather than plasmid-based expression offers superior stability and consistent production levels . Specifically, researchers should consider:

  • Expression System Selection:

    • E. coli BL21(DE3) provides efficient expression for membrane proteins

    • S. flexneri 2a-derived expression systems offer authentic post-translational modifications

  • Gene Integration Strategy:

    • Direct genomic incorporation using lambda Red recombinase system

    • Confirmed site-specific integration through PCR verification

    • Inclusion of appropriate promoters (e.g., T7 or native promoters depending on expression goals)

  • Expression Verification:

    • Western blotting using anti-His tag antibodies (if tagged)

    • Functional assays to confirm flippase activity

    • Proteomic analysis to verify subcellular localization

Expression levels should be monitored and optimized through varying induction conditions (IPTG concentration, temperature, induction time), with membrane fraction isolation performed using standardized ultracentrifugation protocols to maximize recovery of active protein.

What analytical techniques are most effective for studying ArnE-mediated lipid flipping?

The most effective analytical techniques for studying ArnE-mediated lipid flipping combine biochemical assays, advanced imaging, and mass spectrometry approaches:

  • Biochemical Characterization:

    • H-phosphonate-based coupling reactions to synthesize fluorescently labeled Ara4N derivatives

    • In vitro flippase assays using purified membrane vesicles

    • TLC (thin-layer chromatography) for initial product detection

  • Advanced Analytical Methods:

    • LC-ESI-QTOF mass spectrometry for precise product identification and quantification

    • FRET-based assays to monitor real-time flipping kinetics

    • Cryo-electron microscopy for structural analysis of the flippase complex

  • Genetic Approaches:

    • Site-directed mutagenesis to identify essential residues

    • Complementation studies with characterized ArnE variants

    • Conditional knockdown systems to study physiological effects

These combined approaches allow researchers to comprehensively characterize both the mechanism of ArnE-mediated flipping and its functional consequences for bacterial physiology and antibiotic resistance.

How can researchers effectively isolate and purify ArnE protein for structural studies?

Effectively isolating and purifying ArnE protein for structural studies requires specialized approaches for membrane protein work:

  • Optimal Solubilization Protocol:

    • Screening multiple detergents (DDM, LMNG, CHAPS) at various concentrations

    • Evaluation of lipid-detergent mixed micelles to maintain native-like environment

    • Gentle solubilization at reduced temperatures (4°C) to preserve protein integrity

  • Purification Strategy:

    • Two-step affinity chromatography (typically IMAC followed by size exclusion)

    • Addition of stabilizing lipids throughout purification process

    • Buffer optimization to include essential cofactors or ions

  • Quality Assessment Methods:

    • Size-exclusion chromatography to confirm monodispersity

    • Functional assays to verify activity post-purification

    • Negative-stain EM for initial structural assessment

  • Crystallization Considerations:

    • Lipidic cubic phase crystallization for membrane proteins

    • Surface entropy reduction mutants to enhance crystallization propensity

    • Nanobody-assisted crystallization to stabilize flexible regions

For cryo-EM studies, grid preparation with specific detergents or nanodiscs has proven effective for related membrane proteins, potentially offering insights into the dynamic conformational changes associated with the flipping mechanism.

What experimental approaches can determine the substrate specificity of ArnE?

Determining the substrate specificity of ArnE requires a multifaceted experimental approach:

  • Synthetic Substrate Library:

    • Chemical synthesis of phosphodiester-linked Ara4N derivatives with varying lipid chains

    • Systematic modification of the arabinose moiety to probe recognition requirements

    • Fluorescently labeled analogs for binding and transport assays

  • In vitro Flipping Assays:

    • Reconstitution of purified ArnE into proteoliposomes

    • Measurement of translocation rates for different substrates

    • Competition assays between native and modified substrates

  • Binding Studies:

    • Isothermal titration calorimetry (ITC) to determine binding affinities

    • Surface plasmon resonance (SPR) for kinetic analysis

    • Photoaffinity labeling to identify substrate interaction sites

  • Structural Biology Approaches:

    • Co-crystallization with substrate analogs or transition state mimics

    • Molecular dynamics simulations to identify binding pocket characteristics

    • Hydrogen-deuterium exchange mass spectrometry to map substrate-induced conformational changes

This comprehensive approach would enable detailed characterization of both the structural requirements for substrate recognition and the mechanistic aspects of the flipping process.

How can ArnE be targeted for development of novel antimicrobial agents?

ArnE presents a promising target for novel antimicrobial development due to its crucial role in antibiotic resistance mechanisms:

  • Inhibitor Design Strategies:

    • Structure-based design targeting the substrate binding site

    • Development of competitive inhibitors mimicking Ara4N-phosphoundecaprenol

    • Allosteric inhibitors disrupting essential conformational changes

  • Potential Therapeutic Applications:

    • Combination therapy with existing antibiotics like polymyxins

    • Overcoming acquired resistance in multidrug-resistant Shigella

    • Prevention of resistance development during antibiotic treatment

  • Screening Methodologies:

    • High-throughput assays measuring flippase activity inhibition

    • Whole-cell assays measuring restored antibiotic sensitivity

    • In silico screening against modeled binding pockets

  • Challenges and Considerations:

    • Selectivity against bacterial versus human membrane transporters

    • Delivery of inhibitors across bacterial outer membrane

    • Potential for rapid resistance development

By inhibiting ArnE function, these approaches would prevent the critical LPS modifications that contribute to antibiotic resistance, potentially restoring sensitivity to existing antibiotics and offering new treatment options for resistant infections.

What is the comparative genomic landscape of arnE across different Shigella species and strains?

The comparative genomic landscape of arnE across Shigella species reveals important evolutionary patterns:

  • Genetic Conservation Analysis:

    SpeciesarnE ConservationSequence IdentityAssociated Resistance Elements
    S. boydiiHighReferenceOften chromosomal
    S. flexneriHigh92-98%SRL-PAI association variable
    S. sonneiModerate87-95%Frequently associated with AMR elements
    S. dysenteriaeModerate85-93%Often with plasmid-encoded elements
  • Genomic Context Patterns:

    • Chromosomal location typically conserved across species

    • Association with mobile genetic elements varies by species and strain

    • Co-occurrence with other LPS modification genes highly conserved

  • Evolutionary Trends:

    • Evidence of selective pressure in response to antimicrobial use

    • Limited horizontal gene transfer compared to plasmid-mediated resistance genes

    • Species-specific patterns of sequence diversification

The arnE gene shows a distinct evolutionary pattern compared to the acquired resistance determinants documented in historical S. flexneri isolates, which display a wave-like pattern of acquisition over time . This suggests that core LPS modification systems may be subject to different evolutionary constraints than plasmid-mediated resistance mechanisms.

How do flippase mutations impact bacterial fitness and virulence in different environmental conditions?

Flippase mutations create complex fitness and virulence trade-offs across different environmental conditions:

  • Antibiotic Presence vs. Absence:

    • Mutations enhancing flippase activity typically increase antibiotic resistance

    • Same mutations often impose fitness costs in antibiotic-free environments

    • Environmental selection explains geographically restricted spread of certain resistance patterns

  • Host Environment Adaptation:

    • Modified LPS structure affects recognition by host immune components

    • Changes in membrane characteristics influence invasion efficiency

    • Altered outer membrane vesicle composition may impact antigen presentation

  • Environmental Survival:

    • LPS modifications influence persistence in water environments where Shigella is detected

    • Temperature fluctuation tolerance connected to membrane composition

    • Desiccation resistance potentially linked to flippase-mediated membrane properties

  • Competitive Interactions:

    • Co-infection dynamics with strains carrying different flippase variants

    • Differential success in polymicrobial environments

    • Competition between Shigella species with differing LPS modification systems

These multifaceted impacts explain why despite the clear selective advantage of carrying AMR determinants, strains with limited resistance repertoires continue to persist within pathogen populations . This suggests that while there is evolutionary pressure toward increased resistance, it is balanced by other selective factors related to general fitness and environment-specific adaptation.

What are the key challenges in differentiating between ArnE activity and other flippase functions in Shigella boydii?

Differentiating ArnE activity from other flippases presents several technical challenges with specific solutions:

  • Substrate Specificity Overlap:

    • Challenge: Multiple flippases may transport similar lipid substrates

    • Solution: Develop ArnE-specific substrates with unique structural modifications

    • Approach: Synthetic 4-amino-4-deoxy-L-arabinose derivatives with photoaffinity labels

  • Functional Redundancy:

    • Challenge: Backup systems may mask effects of ArnE deletion

    • Solution: Create multiple flippase knockout combinations

    • Approach: CRISPR-Cas9 multiplex editing with inducible complementation systems

  • Assay Specificity Issues:

    • Challenge: Traditional flippase assays lack specificity

    • Solution: Develop ArnE-specific activity measurements

    • Approach: Combine mass spectrometry detection of specific LPS modifications with genetic manipulation

  • Structural Similarity:

    • Challenge: High homology between flippase proteins complicates antibody-based detection

    • Solution: Epitope tagging at non-conserved regions

    • Approach: Careful selection of unique sequence regions for antibody generation

These approaches require integration of synthetic chemistry, molecular biology, and analytical techniques to conclusively distinguish ArnE function from other membrane transporters.

How can researchers effectively model the interaction between ArnE and other components of the LPS modification pathway?

Effective modeling of ArnE interactions within the LPS modification pathway requires integration of multiple approaches:

  • Systems Biology Framework:

    • Comprehensive pathway mapping including all enzymatic steps

    • Integration of transcriptomic and proteomic data to identify coordination mechanisms

    • Flux analysis to identify rate-limiting steps in the pathway

  • Protein-Protein Interaction Studies:

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Bacterial two-hybrid screening for direct binding partners

    • Co-immunoprecipitation validation of key interactions

  • Computational Modeling Approaches:

    • Molecular dynamics simulations of membrane-embedded complexes

    • Docking studies between ArnE and putative interaction partners

    • Machine learning integration of multiple data types to predict functional relationships

  • Experimental Validation Methods:

    • FRET/BRET biosensors to monitor interactions in living cells

    • Reconstitution of minimal systems in proteoliposomes

    • Single-molecule tracking to observe dynamic assembly in native membranes

This integrated approach would illuminate how ArnE functions within the broader context of LPS modification machinery, potentially identifying critical nodes for intervention in the pathway.

What emerging technologies could revolutionize the study of bacterial lipid flippases like ArnE?

Several emerging technologies show promise for transforming flippase research:

  • Advanced Structural Biology:

    • Cryo-electron tomography for in situ visualization

    • Microcrystal electron diffraction for challenging membrane proteins

    • Integrative structural biology combining multiple data sources

  • Single-Molecule Techniques:

    • High-speed atomic force microscopy to observe conformational cycling

    • Single-molecule FRET to track real-time substrate movement

    • Nanopore recording of individual flipping events

  • Synthetic Biology Approaches:

    • Genetically encoded biosensors for lipid flipping

    • Minimal cell systems with defined membrane composition

    • Orthogonal flippase-substrate pairs for specific activity tracking

  • Computational Advances:

    • AI-driven prediction of flippase mechanisms

    • Enhanced molecular dynamics simulations of complete flipping events

    • Quantum mechanical modeling of transition states

These technologies would enable unprecedented insights into the dynamic process of lipid flipping, potentially revealing mechanistic details that remain inaccessible with current approaches.

How might understanding ArnE function contribute to broader antimicrobial resistance strategies?

Understanding ArnE function could significantly impact antimicrobial resistance strategies:

  • Novel Therapeutic Approaches:

    • ArnE inhibitors as antibiotic adjuvants

    • Multi-target therapies addressing parallel resistance mechanisms

    • Predictive modeling of resistance evolution paths

  • Diagnostic Applications:

    • Rapid detection of LPS modifications indicating resistance

    • Biomarkers for predicting treatment failure

    • Personalized antibiotic selection based on resistance mechanism

  • Theoretical Implications:

    • Fundamental insights into evolution of resistance mechanisms

    • Models for predicting cross-resistance patterns

    • Understanding of fitness-resistance trade-offs

  • One Health Integration:

    • Tracking LPS modification systems across environmental, animal, and human isolates

    • Understanding transmission dynamics of resistant strains

    • Targeted interventions based on resistance mechanism distribution

The geographically restricted spread of resistant S. flexneri lineages contrasts with the global dissemination of resistant S. sonnei , suggesting that species-specific factors influence resistance propagation. Understanding these differences could inform surveillance strategies and targeted interventions for different Shigella species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.