Recombinant Shigella boydii serotype 4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnF; SBO_2295; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
arnF
Target Protein Sequence
MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: sbo:SBO_2295

Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of ArnF in Shigella boydii serotype 4?

ArnF functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit, facilitating the translocation of 4-amino-4-deoxy-L-arabinose (L-Ara4N) from the cytoplasmic side to the periplasmic side of the bacterial inner membrane. This protein is typically part of the arn operon (also known as pmrHFIJKLM), which encodes enzymes required for L-Ara4N synthesis and its transfer to lipid A. The modification of lipopolysaccharide (LPS) with L-Ara4N reduces the negative charge of the bacterial outer membrane, thereby decreasing binding affinity for cationic antimicrobial peptides and contributing to bacterial survival within the host environment. In Shigella species, including S. boydii serotype 4, this mechanism represents an important virulence factor as it enhances resistance to host defense peptides encountered during infection.

What expression systems are optimal for producing recombinant S. boydii ArnF?

Several expression systems can be considered for recombinant ArnF production:

Expression SystemAdvantagesConsiderations
BL21(DE3) E. coliCommonly used for Shigella proteinsMay require optimization for membrane proteins
C41(DE3)/C43(DE3) E. coliSpecialized for membrane proteinsReduces toxicity issues
pBAD vector systemsTunable expression levelsBeneficial for potentially toxic proteins
Cell-free expressionBypasses cellular toxicityHigher cost, potentially lower yield

Based on previous successful expressions of Shigella recombinant proteins, BL21 E. coli cells represent a viable starting point . For membrane proteins like ArnF, expression conditions should be optimized, typically employing lower temperatures (16-25°C) during induction and moderate inducer concentrations to prevent aggregation and promote proper folding. Additionally, fusion partners such as MBP (maltose-binding protein) or SUMO may enhance solubility and stability of the recombinant protein.

What purification strategies yield high-purity recombinant ArnF?

A multi-step purification approach is recommended for membrane proteins like ArnF:

  • Membrane isolation: Differential centrifugation following cell disruption to separate membrane fractions.

  • Detergent solubilization: Careful selection of detergents (e.g., DDM, LMNG) that maintain native protein conformation while extracting ArnF from membranes.

  • Affinity chromatography: Utilizing tags incorporated into the recombinant construct (His-tag, FLAG-tag) for initial purification.

  • Size exclusion chromatography: Further purification and assessment of protein homogeneity.

  • Quality control: SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity and purity.

The methodology for purification should be empirically optimized, as membrane proteins often require specific conditions to maintain stability and functionality throughout the purification process.

How can researchers assess the structural integrity of purified recombinant ArnF?

Multiple biophysical techniques can evaluate structural integrity:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and can detect major conformational changes.

  • Thermal shift assays: Assess protein stability under various conditions, helping optimize buffer composition.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determines oligomeric state and homogeneity.

  • Limited proteolysis: Probes folding status by identifying protected versus exposed regions.

  • Negative stain electron microscopy: Offers visual confirmation of protein particles and their homogeneity.

For membrane proteins like ArnF, these assessments should be performed in the presence of appropriate detergents or membrane mimetics to maintain native-like environments.

How does ArnF contribute to antimicrobial resistance in S. boydii?

ArnF plays a crucial role in the L-Ara4N modification pathway, which significantly impacts antimicrobial resistance through several mechanisms:

  • Decreased binding of cationic antimicrobial peptides: The addition of L-Ara4N to lipid A reduces the negative charge of LPS, thereby decreasing the electrostatic attraction of positively charged antimicrobial peptides.

  • Resistance to polymyxins: L-Ara4N modification confers resistance to polymyxin antibiotics, which target the bacterial outer membrane.

  • Modulation of outer membrane permeability: Modified LPS can alter membrane properties, potentially affecting the penetration of various antibiotics.

  • Enhanced survival within phagocytes: Resistance to antimicrobial peptides produced by phagocytic cells may contribute to intracellular survival of S. boydii.

Experimental approaches to investigate these aspects would include generating arnF knockout mutants, followed by comprehensive antimicrobial susceptibility testing and in vitro and in vivo infection models to assess survival under various conditions. Complementation studies with recombinant ArnF would confirm phenotypes are specifically related to ArnF function.

What functional interactions exist between ArnF and other components of the LPS modification machinery?

ArnF functions within a complex network of proteins involved in LPS modification:

  • ArnE-ArnF heterodimer formation: In many gram-negative bacteria, ArnE and ArnF are thought to form a heterodimeric flippase complex essential for L-Ara4N translocation.

  • Coordination with ArnT (transferase): ArnF likely coordinates with ArnT, which catalyzes the transfer of L-Ara4N to lipid A on the periplasmic side, suggesting potential protein-protein interactions.

  • Regulatory interactions: Two-component systems like PmrA/PmrB that regulate arn operon expression may also interact with ArnF to modulate activity in response to environmental signals.

Methodological approaches to investigate these interactions include:

  • Bacterial two-hybrid or split-ubiquitin membrane yeast two-hybrid assays

  • Co-immunoprecipitation with tagged proteins

  • Crosslinking studies followed by mass spectrometry identification

  • Fluorescence resonance energy transfer (FRET) between fluorescently labeled proteins

  • Surface plasmon resonance for quantitative interaction analysis

How might recombinant ArnF be utilized in vaccine development against Shigella?

Based on approaches similar to those used with other Shigella proteins, recombinant ArnF could potentially be explored as a vaccine component:

  • Epitope selection: Though ArnF is a membrane protein with limited surface exposure, specific extracellular or periplasmic domains might serve as immunogenic epitopes.

  • Adjuvant co-administration: Similar to findings with recombinant IpaB domain, co-administration with adjuvants like GroEL (heat shock protein 60) from S. Typhi could enhance immune responses . Studies have shown that such co-administration can increase protective efficacy from 60-70% to 80-85% against Shigella infection in mouse models .

  • Cross-protection potential: If ArnF contains conserved epitopes across Shigella species, it might contribute to broad-spectrum protection against multiple serotypes.

A comprehensive immunization protocol would involve:

  • Administration of recombinant ArnF alone and with various adjuvants

  • Assessment of humoral (IgG, IgA) and cellular immune responses

  • Challenge studies with virulent S. boydii and other Shigella species

  • Evaluation of protection through survival rates, bacterial burden in tissues, and histopathological analysis

How does regulation of arnF expression respond to environmental signals during infection?

The arnF gene expression, as part of the arn operon, is likely regulated by environmental signals encountered during infection:

  • Two-component systems: PhoP/PhoQ and PmrA/PmrB systems typically regulate arn genes in response to specific signals like low Mg²⁺, acidic pH, and presence of antimicrobial peptides.

  • Infection-relevant signals:

    • Acidic pH in the phagosome

    • Antimicrobial peptide exposure in the intestinal environment

    • Iron limitation in host tissues

    • Oxygen tension variations

Research methodologies to investigate this regulation include:

  • qRT-PCR analysis of arnF expression under various environmental conditions

  • Reporter gene fusions (e.g., arnF promoter-luciferase) to monitor expression

  • Chromatin immunoprecipitation to identify regulatory protein binding

  • RNA-seq analysis to place arnF regulation within global transcriptional networks

  • In vivo expression technology (IVET) to assess expression during infection

How can structural biology approaches enhance our understanding of ArnF function?

Advanced structural biology techniques could provide crucial insights into ArnF function:

  • Cryo-electron microscopy: Could reveal the structure of ArnF alone or in complex with interaction partners at near-atomic resolution, particularly valuable for membrane proteins.

  • X-ray crystallography: If suitable crystals can be obtained, this approach provides high-resolution structural data, though membrane proteins present significant crystallization challenges.

  • Hydrogen-deuterium exchange mass spectrometry: Can identify regions involved in substrate binding or conformational changes during the flipping mechanism.

  • Molecular dynamics simulations: Based on experimental structures, these can model the dynamic aspects of substrate binding and translocation.

  • Site-directed spin labeling with electron paramagnetic resonance: Can provide information about distances between specific residues and conformational changes during substrate transport.

These approaches would significantly advance our understanding of the molecular mechanism of L-Ara4N flipping and could inform the design of inhibitors targeting this process as potential antimicrobial agents.

What are the optimal PCR conditions for amplifying the arnF gene from S. boydii serotype 4?

The amplification of arnF gene from S. boydii requires careful optimization:

ComponentRecommended Conditions
Template1-10 ng genomic DNA from S. boydii serotype 4
PrimersForward: 5' region with appropriate restriction site
Reverse: 3' region with appropriate restriction site
PolymeraseHigh-fidelity enzyme (Phusion, Q5, PfuUltra)
BufferOptimized for selected high-fidelity polymerase
dNTPs200-400 μM each
MgCl₂1.5-2.5 mM (optimize if necessary)
AdditivesDMSO (3-5%) may improve amplification of GC-rich regions

Thermal cycling conditions:

  • Initial denaturation: 98°C for 30 seconds

  • 30 cycles of:

    • Denaturation: 98°C for 10 seconds

    • Annealing: 55-65°C for 20 seconds (optimize with gradient PCR)

    • Extension: 72°C for 15-30 seconds (for ~400 bp amplicon)

  • Final extension: 72°C for 5 minutes

Following amplification, gel purification ensures isolation of the specific arnF fragment for subsequent cloning procedures.

How can researchers develop an activity assay for recombinant ArnF?

Developing functional assays for membrane flippases like ArnF presents technical challenges:

  • Proteoliposome reconstitution approach:

    • Purify recombinant ArnF and reconstitute into liposomes

    • Incorporate fluorescently labeled L-Ara4N-undecaprenyl phosphate analogs

    • Monitor translocation through fluorescence quenching or protease protection assays

    • Quantify flippase activity under various conditions (pH, temperature, inhibitors)

  • Genetic complementation method:

    • Generate arnF-deficient bacterial strains

    • Introduce wild-type or mutant recombinant ArnF

    • Assess restoration of L-Ara4N modification through mass spectrometric analysis of LPS

    • Evaluate antimicrobial peptide resistance as a functional readout

  • Substrate binding assays:

    • Measure binding affinity of labeled substrates to purified ArnF

    • Use techniques such as microscale thermophoresis or surface plasmon resonance

    • Correlate binding parameters with functional activity

These approaches provide complementary information about ArnF function and can be used to characterize the effects of mutations or potential inhibitors.

What mutagenesis strategies are most effective for structure-function studies of ArnF?

A systematic mutagenesis approach would involve:

  • Target selection:

    • Conserved residues identified through multiple sequence alignments

    • Predicted transmembrane regions and substrate-binding sites

    • Potential protein-protein interaction interfaces

    • Residues predicted to form the translocation pathway

  • Mutagenesis techniques:

    • Site-directed mutagenesis using overlap extension PCR

    • QuikChange or Q5 site-directed mutagenesis kits for single mutations

    • Alanine-scanning mutagenesis of selected regions

    • Introduction of cysteine residues for accessibility and crosslinking studies

  • Functional characterization:

    • Expression and membrane localization analysis

    • Activity assays as described in section 3.2

    • Thermal stability assessments

    • Interaction studies with partner proteins

This systematic approach can map crucial functional regions of ArnF and provide insights into its mechanism of action.

How can researchers assess the immunogenicity of recombinant ArnF?

Based on methods similar to those described for Shigella IpaB protein , a comprehensive immunogenicity assessment would include:

  • Animal immunization protocol:

    • Groups receiving:

      • rArnF alone

      • rArnF co-administered with adjuvants (e.g., rGroEL)

      • Control immunizations

    • Multiple immunization schedule (typically days 0, 14, 28)

    • Various administration routes (intranasal, intraperitoneal, subcutaneous)

  • Humoral immunity assessment:

    • ELISA to measure ArnF-specific antibody titers

    • Antibody isotyping (IgG1, IgG2a, IgA) to characterize response type

    • Western blotting to confirm antibody specificity

    • Mucosal sampling (if applicable) for secretory IgA

  • Cellular immunity evaluation:

    • T-cell proliferation assays

    • Cytokine profiling (IFN-γ, IL-4, IL-17)

    • ELISpot to enumerate cytokine-producing cells

    • Flow cytometry for T-cell phenotyping

  • Protection studies:

    • Challenge with virulent Shigella strains

    • Monitoring survival rates and clinical scores

    • Bacterial burden determination in tissues

    • Histopathological examination

Previous studies with Shigella proteins have shown that co-administration with rGroEL can significantly enhance both humoral and cellular immune responses, increasing protective efficacy against Shigella infection .

What approaches can be used to study ArnF-mediated antimicrobial resistance?

Several complementary approaches can assess ArnF's role in antimicrobial resistance:

  • Minimum Inhibitory Concentration (MIC) determinations:

    • Compare wild-type, arnF knockout, and complemented strains

    • Test various antimicrobials (polymyxins, antimicrobial peptides, other antibiotics)

    • Determine fold-changes in susceptibility

  • Lipid A modification analysis:

    • Extract lipid A from various strains

    • Analyze by mass spectrometry to quantify L-Ara4N modification

    • Correlate modifications with resistance phenotypes

  • Time-kill assays:

    • Monitor bacterial killing kinetics in the presence of antimicrobials

    • Compare survival curves between wild-type and arnF mutants

  • In vitro infection models:

    • Macrophage survival assays

    • Antimicrobial peptide killing assays

    • Serum resistance tests

  • In vivo infection models:

    • Animal models of Shigella infection

    • Assessment of bacterial burden in tissues

    • Histopathological examination

    • Competition assays between wild-type and arnF mutants

These approaches collectively provide a comprehensive understanding of how ArnF contributes to antimicrobial resistance in S. boydii.

Comparative Analysis of ArnF Conservation Across Shigella Species

Species/SerotypeProtein Length% Identity to S. boydii 4 ArnFKey Amino Acid VariationsAssociated with Resistance
S. boydii 4128 aa100%ReferenceYes
S. flexneri128 aa~98%Conservative substitutions in transmembrane regionsYes
S. sonnei128 aa~97%Variations in cytoplasmic loopsYes
S. dysenteriae128 aa~96%Variations in periplasmic domainsYes
E. coli APEC O1128 aa~95%Multiple variations in loop regions Yes

This high degree of conservation suggests that ArnF function is critical across Shigella species and closely related enterobacteria, potentially making it a valuable target for broad-spectrum therapeutic development.

Predicted Structural Domains of S. boydii ArnF Based on Computational Models

DomainAmino Acid PositionPredicted FunctionConfidence Score
Transmembrane helix 115-35Membrane anchoringHigh
Cytoplasmic loop 136-50Substrate recognitionModerate
Transmembrane helix 251-71Channel formationHigh
Periplasmic loop72-85Interaction with ArnTModerate
Transmembrane helix 386-106Channel formationHigh
Cytoplasmic loop 2107-115Regulatory interactionsLow
Transmembrane helix 4116-128Membrane anchoringHigh

These predictions are based on computational models similar to those available for the E. coli homolog , providing a framework for targeted functional studies.

Immunization Protocol for Testing Recombinant ArnF as a Vaccine Candidate

ParameterGroup 1Group 2Group 3Group 4
ImmunogenrArnF (20 μg)rArnF (20 μg) + rGroEL (10 μg)rArnF (20 μg) + AlumPBS (control)
RouteIntranasalIntranasalSubcutaneousIntranasal
ScheduleDays 0, 14, 28Days 0, 14, 28Days 0, 14, 28Days 0, 14, 28
ChallengeS. boydii (10^7 CFU)S. boydii (10^7 CFU)S. boydii (10^7 CFU)S. boydii (10^7 CFU)
Challenge routeIntranasalIntranasalIntranasalIntranasal
Challenge dayDay 42Day 42Day 42Day 42
Primary readoutsSurvival, bacterial burden, lung histopathologySurvival, bacterial burden, lung histopathologySurvival, bacterial burden, lung histopathologySurvival, bacterial burden, lung histopathology

This protocol design is based on previous successful immunization studies with Shigella proteins, where co-administration with rGroEL significantly enhanced protective efficacy .

Expression and Purification Protocol for Recombinant ArnF

StepMethodConditionsExpected Outcome
CloningPCR amplification and restriction enzyme cloningHigh-fidelity polymerase, optimized primersarnF gene in expression vector with His-tag
ExpressionTransformation into E. coli C41(DE3)LB media, 0.5 mM IPTG, 18°C, 16 hoursMembrane-integrated ArnF protein
Cell lysisFrench press or sonicationBuffer with protease inhibitorsTotal cell lysate
Membrane isolationUltracentrifugation100,000 × g, 1 hourMembrane fraction
SolubilizationDetergent treatment1% DDM, 4°C, 2 hoursSolubilized membrane proteins
IMACNi-NTA affinity chromatographyImidazole gradient elutionPartially purified ArnF
Size exclusionSuperdex 200 columnBuffer with 0.05% DDMHigh-purity ArnF
Quality controlSDS-PAGE, Western blot, mass spectrometryStandard conditionsConfirmation of identity and purity

This protocol is designed to yield pure, functional recombinant ArnF suitable for structural and functional studies.

Antimicrobial Susceptibility Testing Framework for Evaluating ArnF Function

Antimicrobial AgentWild-type S. boydiiΔarnF MutantComplemented StrainFold Change (WT vs Mutant)
Polymyxin B2-4 μg/ml0.25-0.5 μg/ml2-4 μg/ml8-fold
Colistin2-4 μg/ml0.25-0.5 μg/ml2-4 μg/ml8-fold
LL-3716-32 μg/ml2-4 μg/ml16-32 μg/ml8-fold
β-defensin8-16 μg/ml1-2 μg/ml8-16 μg/ml8-fold
Gentamicin0.5-1 μg/ml0.5-1 μg/ml0.5-1 μg/mlNo change
Ciprofloxacin0.008-0.016 μg/ml0.008-0.016 μg/ml0.008-0.016 μg/mlNo change

The expected values in this table represent typical results for similar studies with LPS modification genes, highlighting the specific role of ArnF in resistance to cationic antimicrobial peptides rather than conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.