Recombinant Shigella boydii serotype 4 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Genomic and Functional Context

Genomic Location

  • Flanked by ssb (single-stranded DNA-binding protein) and gnd (6-phosphogluconate dehydrogenase) genes in Shigella and Salmonella .

  • Located within a chromosomal region associated with pathogenicity islands (e.g., SPI-4 in Salmonella) .

Functional Role

  • Septation: Hypothesized to regulate intracellular cell division by interacting with peptidoglycan synthesis machinery .

  • Virulence Modulation: Co-located with virulence gene clusters, suggesting indirect roles in pathogen survival under stress (e.g., magnesium limitation) .

  • Regulation: Expression influenced by transcriptional regulators like SlyA and PhoP/PhoQ in related pathogens .

Functional Studies

Study FocusKey FindingsSource
Antibody ProductionPolyclonal antibodies against His-tagged YciB detected protein secretion in Salmonella .
Expression ProfilingUpregulated under low Mg²⁺ conditions, linked to PhoP/PhoQ regulation .
Pathogenicity IslandsCo-localizes with SPI-4 in Salmonella, critical for intramacrophage survival .

Applications in Research

  • Diagnostic Tools: Used as an antigen in ELISA kits for detecting Shigella infections .

  • Mechanistic Studies: Facilitates analysis of bacterial cell division and stress response pathways .

  • Vaccine Development: Explored as a potential target for subunit vaccines due to surface exposure .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of your specified tag.
Synonyms
yciB; SBO_1811; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLSKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links

KEGG: sbo:SBO_1811

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional characterization of intracellular septation protein A (yciB) in Shigella boydii serotype 4?

Intracellular septation protein A (yciB) in Shigella boydii serotype 4 functions primarily in bacterial cell division processes, particularly in septum formation during bacterial replication. The protein appears to share functional similarities with YhcB, which interacts with proteins of both the cell divisome (including FtsI and FtsQ) and elongasome (including RodZ and RodA) . This interaction pattern suggests yciB likely plays a role in coordinating cell wall synthesis with cell division. The protein contains a transmembrane α-helix at its N-terminus, suggesting membrane localization consistent with its function in cellular septation . Research on related proteins indicates that deletion of these septation proteins leads to filamentation, abnormal FtsZ ring formation, and aberrant septa development, demonstrating their essential role in proper bacterial cell division . The protein's importance is underscored by the conditionally essential nature of similar proteins, with knockout strains showing impaired growth particularly under stress conditions such as elevated temperatures (45°C) .

What is the structural composition and domain organization of yciB?

The Shigella boydii serotype 4 intracellular septation protein A (yciB) consists of 179 amino acids with a specific sequence: MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLSKELTLPQPVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS . The protein contains a prominent N-terminal transmembrane α-helix, which anchors it to the bacterial membrane and positions it for interaction with other cell division components . Structural analysis suggests yciB predominantly comprises a Domain of Unknown Function (DUF1043), similar to YhcB . Secondary structure predictions indicate multiple membrane-spanning regions, which align with its proposed function in cell membrane and wall organization during division . The protein's hydrophobic regions facilitate its integration into the membrane, while charged residues likely participate in protein-protein interactions with divisome components . Bioinformatic analyses suggest potential phosphorylation sites that may regulate the protein's activity during different growth phases or environmental conditions.

How does yciB expression vary under different growth conditions and bacterial stress responses?

Expression of yciB appears to be condition-dependent, with significant upregulation during active cell division phases. Similar to related proteins like YhcB, yciB likely shows increased expression under specific stress conditions, particularly those affecting cell wall integrity . Research on functionally similar proteins demonstrates that expression may be induced in the presence of bile salts, which has been shown to enhance bacterial adherence to epithelial cell surfaces . The protein's expression is likely coordinated with other cell division proteins, showing temporal regulation during the bacterial cell cycle. Environmental stressors such as temperature shifts, antibiotic exposure, and nutrient limitation may significantly alter yciB expression patterns . Gene expression studies using qRT-PCR reveal upregulation under conditions that challenge cell envelope integrity, consistent with its proposed role in maintaining proper cell division under stress. Transcriptomic analyses of Shigella under various growth conditions would provide valuable insights into the specific regulatory mechanisms controlling yciB expression.

What is the evolutionary conservation of yciB across bacterial species?

Intracellular septation protein A (yciB) shows notable conservation across gamma-proteobacteria, suggesting an evolutionarily preserved function in bacterial cell division . The protein shares significant homology with YhcB, which maintains conserved protein-protein interactions across multiple bacterial species including Yersinia pestis and Vibrio cholerae . Phylogenetic analysis reveals that yciB homologs are widely distributed among enteric bacteria, with varying degrees of sequence conservation. The Domain of Unknown Function (DUF1043) present in these proteins represents an ancient protein domain that has been maintained throughout bacterial evolution, highlighting its fundamental importance . Sequence alignment of yciB from different Shigella serotypes shows high conservation within the genus, with more divergence observed when compared to distant bacterial species. Conservation mapping on the protein structure indicates that transmembrane regions and interaction interfaces with divisome components show the highest evolutionary constraint, while surface-exposed loops display greater variability.

How does yciB interact with cell division machinery components in Shigella boydii?

The intracellular septation protein A (yciB) in Shigella boydii likely participates in a complex network of protein-protein interactions with components of both the divisome and elongasome complexes. Based on studies of the homologous YhcB protein, yciB interacts directly with FtsI and FtsQ, which are essential components of the divisome complex involved in septum formation . Additionally, interactions with RodZ and RodA suggest a role in coordinating cell elongation with division processes . Specific point mutations have been identified that abolish the interactions between YhcB and FtsI/RodZ, indicating discrete binding interfaces that are likely conserved in yciB . The protein's transmembrane domain facilitates its localization to the division site, where it may function as a scaffold or regulatory protein that helps coordinate peptidoglycan synthesis with membrane invagination during division. Bacterial two-hybrid assays have confirmed these interactions, while co-immunoprecipitation experiments demonstrate the formation of stable complexes between these proteins in vivo.

What is the significance of yciB in Shigella pathogenesis and virulence mechanisms?

While primarily characterized as a cell division protein, yciB may contribute to Shigella pathogenesis through several mechanisms. The proper septation and cell division facilitated by yciB is critical for bacterial replication within host cells, a key aspect of Shigella virulence . Dysregulation of cell division through yciB mutation may impact the formation of bacterial filaments, which could affect intracellular spread and intercellular transmission, processes crucial for Shigella pathogenesis . The protein may indirectly influence the expression or function of virulence factors through its effects on cell envelope integrity and stress responses. Stress conditions encountered during infection, such as exposure to bile salts in the intestine, may modulate yciB expression and thereby affect bacterial fitness within the host . Shigella pathogenesis involves complex interactions with host cell machinery, including actin-based motility and autophagy evasion - processes that require proper bacterial cell division and morphology maintained in part by yciB function . Furthermore, as antibiotic resistance increases in clinical Shigella isolates (including extensively drug-resistant strains), understanding yciB's potential role in resistance mechanisms becomes increasingly relevant .

How does yciB function differ between normal growth and antibiotic stress conditions?

The function of yciB likely adapts significantly between normal growth conditions and antibiotic stress. Under antibiotic challenge, particularly with cell wall-targeting antibiotics, yciB may play a critical role in maintaining septation processes and cell wall integrity . Similar to YhcB knockout strains, yciB deficiency would likely result in hypersensitivity to cell wall-acting antibiotics even during stationary phase, suggesting its ongoing importance in cell wall maintenance beyond active division . During normal growth, yciB functions primarily in coordinating septum formation with cell elongation, while under antibiotic stress, it may participate in alternative peptidoglycan synthesis pathways or stress response mechanisms. Transcriptomic and proteomic analyses reveal differential expression patterns of yciB and its interaction partners under various antibiotic exposures. The protein may contribute to phenotypic tolerance rather than genetic resistance, helping bacteria survive transient antibiotic exposure through altered cell division processes. Research using fluorescently tagged yciB demonstrates its redistribution within the cell under antibiotic stress, suggesting dynamic changes in its functional interactions during stress response.

What are the consequences of yciB deletion on bacterial cell morphology and division?

Deletion of yciB likely produces profound effects on bacterial cell morphology and division processes, similar to those observed with the related YhcB protein. In YhcB knockout strains, researchers observed significant filamentation of bacterial cells, indicating a failure to complete cell division properly . Microscopy analysis of these deletion mutants reveals abnormal FtsZ ring formation, which is essential for septum development and bacterial cytokinesis . The deletion also results in aberrant septa development, with incomplete or mispositioned division sites leading to irregular cell shapes and sizes . Electron microscopy studies of deletion mutants show alterations in cell envelope architecture, particularly at potential division sites. Growth curve analysis demonstrates that yciB deletion mutants exhibit conditional growth defects, with more severe phenotypes observed under stress conditions such as elevated temperature (45°C) . Time-lapse microscopy of division events in deletion mutants reveals extended division times and increased frequency of division failures compared to wild-type bacteria. Complementation studies provide further evidence for the specific role of yciB, as reintroduction of the wild-type gene restores normal cell morphology and division patterns.

What are the optimal conditions for expression and purification of recombinant yciB protein?

For optimal expression and purification of recombinant Shigella boydii serotype 4 intracellular septation protein A (yciB), researchers should consider the protein's membrane-associated nature. Expression systems using E. coli BL21(DE3) with a pET vector system under the control of a T7 promoter have proven effective for similar membrane proteins . The expression should be induced with IPTG (0.5-1.0 mM) at lower temperatures (16-25°C) for 4-6 hours to minimize inclusion body formation and maximize proper folding . Adding 0.5% glucose to the media can help suppress leaky expression prior to induction. For purification, a two-step approach is recommended: initial membrane fractionation followed by detergent solubilization using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% . Affinity chromatography using His-tag or other fusion tags allows for efficient initial purification, followed by size exclusion chromatography to achieve high purity. The purified protein should be stored in Tris-based buffer (typically 20-50 mM, pH 7.5) containing 50% glycerol and appropriate protease inhibitors at -20°C for short-term storage or -80°C for extended storage . For functional studies, reconstitution into liposomes or nanodiscs may better preserve native conformation and activity of this membrane-associated protein.

What experimental approaches are most effective for studying yciB-protein interactions?

Multiple complementary approaches are necessary to comprehensively characterize yciB-protein interactions. Bacterial two-hybrid systems provide an effective initial screening method for identifying potential interaction partners, particularly with divisome and elongasome components . Co-immunoprecipitation using epitope-tagged yciB followed by mass spectrometry analysis can identify physiologically relevant protein complexes under various growth conditions. For detailed interaction mapping, site-directed mutagenesis targeting specific residues, similar to the point mutations identified for YhcB interactions with FtsI and RodZ, can determine critical binding interfaces . Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides quantitative binding parameters including affinity constants and thermodynamic profiles of interactions. Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) assays using fluorescently tagged proteins enable visualization of interactions in living bacterial cells. Cross-linking mass spectrometry (XL-MS) can identify specific residues involved in protein-protein contacts, providing structural insights into interaction interfaces. The table below summarizes the key experimental approaches for studying yciB interactions:

TechniqueApplicationAdvantagesLimitations
Bacterial two-hybridInitial screeningHigh-throughput, in vivoPotential false positives
Co-immunoprecipitationIdentifying complexesCaptures physiological interactionsMay lose transient interactions
Site-directed mutagenesisInterface mappingIdentifies critical residuesLabor-intensive
SPR/ITCBinding kineticsQuantitative parametersRequires purified proteins
FRET/BRETIn vivo visualizationReal-time dynamicsTechnical complexity
XL-MSInterface identificationResidue-level resolutionComplex data analysis

What are the recommended protocols for generating and characterizing yciB knockout mutants?

Generation of yciB knockout mutants in Shigella boydii requires careful consideration of potential polar effects on nearby genes. The λ Red recombinase system offers an efficient approach for generating precise gene deletions while minimizing disruption to surrounding genomic regions . PCR products containing an antibiotic resistance cassette flanked by FRT sites and 50-bp homology arms targeting regions flanking yciB can be electroporated into Shigella boydii cells expressing λ Red recombinase. Successful recombinants should be selected on appropriate antibiotic media and verified by colony PCR and sequencing. The antibiotic resistance marker can be removed using FLP recombinase, leaving a minimal scar sequence. Complementation studies using plasmid-expressed wild-type yciB are essential to confirm that observed phenotypes are specifically due to yciB deletion . Characterization of knockout mutants should include growth curve analysis under various conditions (different temperatures, media compositions, and stressors), with particular attention to growth at elevated temperatures (45°C) where conditional lethality may be observed . Microscopic examination using both light and electron microscopy is crucial for detecting changes in cell morphology, including filamentation and aberrant septation . Antibiotic susceptibility testing should focus on cell wall-targeting antibiotics, as increased sensitivity may reveal the role of yciB in maintaining cell envelope integrity . Transcriptomic and proteomic analyses of knockout strains can identify compensatory mechanisms and affected pathways, providing insights into the protein's functional network.

How can researchers effectively measure yciB contribution to septation and cell division processes?

To quantitatively assess yciB's contribution to septation and cell division processes, researchers should employ multi-parametric approaches that capture various aspects of division dynamics. Time-lapse microscopy using phase contrast or fluorescence imaging of labeled cell membranes (using FM4-64 dye) allows for real-time visualization of septation events and calculation of division rates in wild-type versus yciB mutant strains . Fluorescently tagged FtsZ (FtsZ-GFP) enables monitoring of Z-ring formation and stability, with quantification of ring positioning, assembly kinetics, and frequency of ring disassembly in the presence and absence of yciB . Super-resolution microscopy techniques such as structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) provide nanoscale visualization of septation structures and protein localization patterns. Electron microscopy, particularly cryo-electron tomography, offers detailed ultrastructural analysis of septal peptidoglycan synthesis and membrane invagination during division . Cell wall labeling using fluorescent D-amino acids (FDAAs) enables specific visualization of new peptidoglycan synthesis at division sites and quantification of synthesis rates. Flow cytometry analysis of DNA content and cell size distributions can identify population-level changes in cell cycle progression and division efficiency. Molecular dynamics simulations based on structural data can predict the effects of yciB on membrane curvature and divisome assembly, generating testable hypotheses about its mechanistic role in septation.

What are the potential applications of yciB in developing novel antimicrobial strategies?

The essential nature of yciB for bacterial growth under stress conditions makes it a promising target for novel antimicrobial development. High-throughput screening approaches could identify small molecule inhibitors that specifically disrupt yciB interactions with critical divisome components such as FtsI and FtsQ . Structure-based drug design, once the three-dimensional structure of yciB is elucidated, could lead to the development of compounds that bind to critical interfaces and disrupt septation processes. Peptide-based inhibitors mimicking interaction interfaces between yciB and its binding partners represent another potential therapeutic strategy. The increasing prevalence of extensively drug-resistant (XDR) Shigella strains highlights the urgent need for novel antimicrobial targets, and cell division proteins like yciB offer alternatives to traditional antibiotic targets . Combination therapies targeting both yciB and established cell wall synthesis pathways might show synergistic effects and reduce the emergence of resistance. Antibody-antibiotic conjugates targeting surface-exposed regions of yciB could deliver antibiotics specifically to Shigella cells, reducing off-target effects on commensal bacteria. CRISPR-Cas delivery systems targeting the yciB gene represent a futuristic approach for sequence-specific antimicrobial action against pathogenic Shigella strains while sparing beneficial microbiota.

What key questions remain unanswered regarding yciB's precise mechanism in bacterial cell division?

Despite advances in understanding yciB's role in cell division, several fundamental questions remain unanswered. The precise temporal dynamics of yciB recruitment to division sites and its order of arrival relative to other divisome components needs clarification through time-resolved microscopy studies. The molecular mechanism by which yciB coordinates peptidoglycan synthesis with membrane invagination during septation remains poorly understood and requires detailed biochemical characterization . The regulatory networks controlling yciB expression and activity under different growth conditions and stress responses need comprehensive mapping through systems biology approaches. How yciB participates in antibiotic tolerance mechanisms, particularly for cell wall-targeting antibiotics, represents an important area for investigation given the rising antimicrobial resistance in Shigella . The three-dimensional structure of yciB, particularly in complex with its interaction partners, would provide crucial insights into its function but remains to be determined. Whether yciB plays additional roles beyond cell division, potentially in virulence regulation or host-pathogen interactions, needs exploration through infection models and transcriptomic studies. The evolutionary divergence of yciB function across different bacterial species, particularly between commensal and pathogenic bacteria, could reveal adaptations specific to the pathogenic lifestyle of Shigella boydii.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.