Recombinant Shigella boydii serotype 4 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Lgt is a membrane-associated enzyme responsible for the first step in bacterial lipoprotein maturation. It catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol (PG) to the thiol group of a conserved cysteine residue in prolipoproteins . This posttranslational modification is essential for membrane anchoring and stability of lipoproteins in Gram-negative bacteria like Shigella boydii . Recombinant versions, such as the S. boydii serotype 4 Lgt, are produced for structural and functional studies.

Biochemical Function and Mechanism

Lgt operates through a two-step enzymatic process:

  1. Substrate Binding: Recognizes the signal peptide of nascent prolipoproteins .

  2. Diacylglyceryl Transfer: Transfers a diacylglyceryl moiety from PG to the cysteine thiol, forming a thioether bond .

Catalytic Mechanism:

  • A catalytic histidine residue facilitates nucleophilic attack by the cysteine thiol on PG .

  • Products include diacylated prolipoprotein (pBLP) and glycerol-1-phosphate .

Table 1: Physical Properties

ParameterDetails
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C (short-term), -80°C (long-term)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 50% glycerol recommended

Table 2: Functional Stability

ConditionRecommendation
Freeze-Thaw CyclesAvoid repeated cycles
Working AliquotsStore at 4°C for ≤1 week

Research Findings and Applications

  • Essentiality: Lgt is critical for Shigella pathogenicity, as knockout strains show reduced virulence .

  • Antibiotic Target: Inhibitors of Lgt could disrupt lipoprotein trafficking, offering therapeutic potential .

  • Structural Insights: Crystal structures reveal a conserved catalytic pocket, aiding drug design .

Genomic Context and Phylogenetic Insights

S. boydii serotype 4 belongs to phylogenetic clade 1, distinguished by unique gene clusters encoding transport systems and zinc-binding proteins . The lgt gene is conserved across Shigella species, underscoring its functional importance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
lgt; SBO_2720; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVSMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links

KEGG: sbo:SBO_2720

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its role in bacteria?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme that catalyzes the first lipid-posttranslational modification in the bacterial lipoprotein processing pathway. It converts preprolipoprotein (ppBLP) to prolipoprotein (pBLP) by transferring a diacylglyceryl moiety from phosphatidylglycerol (PG) to the thiol group on the invariant lipobox cysteine of the substrate. This reaction creates a thioether link that anchors the lipoprotein to the bacterial membrane via two fatty acyl chains . The enzyme is essential in Gram-negative bacteria and often required for virulence in Gram-positive species. In Shigella species, including Shigella boydii serotype 4, lgt plays a crucial role in membrane integrity and pathogenesis .

What is the significance of studying Shigella boydii serotype 4 lgt specifically?

Shigella boydii represents one of the four major subgroups (Group C) of Shigella species and comprises 19 distinct serotypes, including serotype 4 . While Shigella infections primarily cause gastrointestinal disease, they can lead to extraintestinal manifestations including rare urinary tract infections. Understanding the molecular mechanisms of virulence factors like lgt in specific serotypes such as Shigella boydii serotype 4 can provide insights into serotype-specific pathogenesis patterns, host-pathogen interactions, and potential targets for therapeutic intervention . The recombinant expression of this protein enables detailed structural and functional studies that may reveal unique properties compared to lgt from other bacterial species or serotypes.

How does Shigella boydii serotype 4 lgt compare structurally and functionally to lgt in other bacterial species?

Based on existing research on bacterial lgt proteins, Shigella boydii serotype 4 lgt likely shares the core structural features common to this enzyme family. These include multiple transmembrane helices (TMHs) forming major and minor TMH domains with a catalytic cleft between them . The highly conserved His-Gly-Gly-Leu motif, containing the catalytic histidine (corresponding to His103 in E. coli), is likely present and essential for its enzymatic function .

What are the optimal conditions for recombinant expression of Shigella boydii serotype 4 lgt?

For recombinant expression of membrane proteins like lgt from Shigella boydii serotype 4, several expression systems can be considered with the following recommended conditions:

Table 1: Recommended Expression Systems for Recombinant Shigella boydii serotype 4 lgt

Expression SystemVector TypeInduction ConditionsAdvantagesChallenges
E. coli BL21(DE3)pET with C-terminal His-tagIPTG 0.5 mM, 20°C, 16-18 hoursHigh yield, genetic similarity to ShigellaPotential toxicity, inclusion body formation
E. coli C43(DE3)pWaldo-GFPeIPTG 0.4 mM, 25°C, 20 hoursSpecialized for membrane proteins, GFP fusion for folding assessmentLower yield, potential GFP interference with function
Cell-free expressionpIVEX30°C, 16 hours with supplied nanodiscsAvoids toxicity issues, direct incorporation into membrane mimeticsHigher cost, technical complexity

For optimal purification, a two-step approach is recommended: nickel affinity chromatography followed by size exclusion chromatography, using buffers containing appropriate detergents (e.g., DDM or LMNG) to maintain protein stability and activity. Protein quality should be assessed through SDS-PAGE, Western blotting, and activity assays before proceeding to structural or functional studies .

What assays are available for measuring the enzymatic activity of recombinant Shigella boydii serotype 4 lgt?

Several complementary approaches can be employed to assess the enzymatic activity of recombinant Shigella boydii serotype 4 lgt:

  • Luciferase-coupled assay: This recently developed assay exploits lgt's ability to produce glycerol-3-phosphate as one of its products. The glycerol-3-phosphate can be detected via a coupled enzymatic reaction that ultimately produces luminescence, providing a sensitive and quantitative readout of activity .

  • Radiolabeled substrate assay: Using radiolabeled phosphatidylglycerol (typically 14C or 3H-labeled) and tracking the transfer of the diacylglyceryl moiety to a model peptide substrate containing the lipobox sequence.

  • Mass spectrometry-based assay: Monitoring the conversion of synthetic peptide substrates to their lipidated forms using liquid chromatography-mass spectrometry (LC-MS).

  • In vivo complementation assay: Testing whether Shigella boydii serotype 4 lgt can functionally complement lgt-deficient strains of related bacteria, particularly useful for assessing mutant variants.

When performing these assays, it's crucial to optimize substrate concentrations, pH, temperature, and buffer conditions. A typical reaction buffer might contain 50 mM HEPES (pH 7.5), 150 mM NaCl, 10 mM MgCl2, and appropriate detergent concentrations to maintain enzyme solubility without inhibiting activity.

How can site-directed mutagenesis be used to study the catalytic mechanism of Shigella boydii serotype 4 lgt?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationships of Shigella boydii serotype 4 lgt. Based on structural and mechanistic information from other bacterial lgt enzymes, several key residues would be priority targets for mutagenesis:

Table 2: Key Residues for Site-Directed Mutagenesis Studies of lgt

Target ResidueCorresponding Position in E. coliSuggested MutationsExpected OutcomeValidation Method
Catalytic histidineHis103H→N, H→Q, H→AComplete loss of activityActivity assays
Conserved glycines in H-G-G-L motifGly104, Gly105G→A, G→VReduced activity due to steric hindranceActivity assays, thermal stability
Conserved leucineLeu106L→A, L→FAltered substrate specificitySubstrate preference analysis
Residues lining lipid-binding pocketVariousPolarity-altering substitutionsChanged lipid substrate preferenceLipid substrate competition assays
Residues at the entrance of the front cleftVariousCharge-inverting substitutionsAltered preprolipoprotein recognitionProtein substrate kinetics

How does the conformational dynamics of Shigella boydii serotype 4 lgt contribute to its catalytic mechanism?

The catalytic mechanism of lgt involves complex conformational dynamics that facilitate substrate binding, catalysis, and product release. Based on molecular dynamics studies of related lgt enzymes, Shigella boydii serotype 4 lgt likely undergoes several conformational changes during its catalytic cycle .

The enzyme appears to have two major binding clefts: a side cleft between the major and minor transmembrane helix domains containing the catalytic His-Gly-Gly-Leu motif, and a front cleft that may serve as the initial docking site for the preprolipoprotein substrate. Molecular dynamics simulations suggest a possible mechanistic model where:

  • The phosphatidylglycerol (PG) substrate binds within the active site.

  • The preprolipoprotein substrate initially binds at the front cleft, away from the catalytic histidine.

  • The preprolipoprotein then moves into the active site, approaching both the catalytic histidine and the PG substrate.

  • This movement triggers conformational changes in the enzyme, including the opening of a periplasmic gate formed by a loop between transmembrane helices 6 and 7.

  • The catalytic histidine abstracts a proton from the thiol group of the lipobox cysteine, generating a reactive thiolate.

  • This nucleophile attacks the ester bond between the phosphate and diacylglyceryl moiety of PG.

  • The prolipoprotein product departs through the side cleft, facilitated by the open gate.

  • The glycerol-1-phosphate byproduct diffuses into the periplasm .

To experimentally investigate these dynamics in Shigella boydii serotype 4 lgt, researchers could employ:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility during catalysis

  • Single-molecule FRET to monitor domain movements in real-time

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to measure distances between specific sites during the catalytic cycle

What is the interplay between lgt and other enzymes in the lipoprotein processing pathway in Shigella boydii serotype 4?

In the canonical bacterial lipoprotein processing pathway, lgt works in concert with two other enzymes: lipoprotein signal peptidase (LspA) and apolipoprotein N-acyl transferase (Lnt). This coordinated enzymatic cascade ensures proper maturation of bacterial lipoproteins .

In Shigella boydii serotype 4, this pathway likely follows the general scheme:

  • Lgt catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the lipobox cysteine in preproproteins, producing proproteins (pBLPs).

  • LspA cleaves the signal peptide to the N-terminal side of the lipidated cysteine, generating diacylated-BLPs (DA-BLPs).

  • Lnt transfers an acyl chain, preferentially from phosphatidylethanolamine, to the free ammonium group on the lipidated N-terminal cysteine, producing triacylated-BLPs (TA-BLPs) .

Table 3: Comparison of Enzymes in the Lipoprotein Processing Pathway

EnzymePrimary FunctionSubstrateProductEssential in Gram-negative Bacteria?Potential for Research in Shigella boydii
LgtDiacylglyceryl transferPreprolipoprotein (ppBLP)Prolipoprotein (pBLP)YesHigh - potential antimicrobial target
LspASignal peptide cleavageProlipoprotein (pBLP)Diacylated-BLP (DA-BLP)YesHigh - target of globomycin antibiotic
LntN-acylationDiacylated-BLP (DA-BLP)Triacylated-BLP (TA-BLP)YesMedium - less essential in some contexts

To study this pathway in Shigella boydii serotype 4, researchers could:

  • Develop a reconstituted in vitro system with all three purified enzymes

  • Use mass spectrometry to track modifications of model lipoprotein substrates

  • Create conditional knockdowns or temperature-sensitive mutants to observe the effects of pathway disruption on bacterial physiology and virulence

  • Investigate potential differences in substrate specificity compared to other bacterial species

How might inhibition of Shigella boydii serotype 4 lgt affect bacterial pathogenesis in urinary tract infections?

While Shigella infections primarily manifest as gastrointestinal disease, extraintestinal complications including urinary tract infections (UTIs) have been documented, though they are relatively uncommon . Shigella sonnei has been specifically reported in cases of UTIs, but the principles may apply to Shigella boydii as well .

Inhibition of lgt in Shigella boydii serotype 4 could potentially impact pathogenesis in urinary tract infections through several mechanisms:

  • Membrane integrity disruption: Lipoproteins are critical components of bacterial outer membranes. Inhibiting lgt would prevent proper anchoring of these proteins, potentially compromising membrane integrity and increasing susceptibility to host defense mechanisms in the urinary tract environment.

  • Virulence factor attenuation: Many bacterial lipoproteins function as virulence factors involved in adhesion, invasion, and immune evasion. Improperly processed lipoproteins would likely have reduced functionality, potentially attenuating virulence.

  • Altered immune recognition: Bacterial lipoproteins are potent activators of innate immunity through Toll-like receptor 2 (TLR2). Changes in lipoprotein processing could alter immune recognition patterns in the urinary tract.

  • Stress response impairment: Many lipoproteins participate in stress response pathways. Their dysfunction might reduce bacterial survival in the challenging urinary tract environment.

Research approaches to investigate these effects could include:

  • Development of specific lgt inhibitors and testing their efficacy in cell culture and animal models of Shigella UTI

  • Creation of conditional lgt mutants to study the effects of lgt depletion on Shigella boydii colonization and persistence in the urinary tract

  • Comparative proteomics analysis of wild-type versus lgt-inhibited Shigella boydii to identify affected lipoproteins and their roles in UTI pathogenesis

  • Immunological studies to determine how lgt inhibition affects host recognition and response to Shigella infection in the urinary tract

What are the challenges in crystallizing Shigella boydii serotype 4 lgt and how can they be overcome?

Crystallizing membrane proteins like lgt presents significant challenges due to their hydrophobic nature and requirement for detergents or membrane mimetics. For Shigella boydii serotype 4 lgt, researchers might encounter several specific difficulties:

  • Protein stability: Maintaining the stability of lgt during purification and crystallization attempts can be problematic.

  • Detergent selection: Finding the optimal detergent that maintains protein activity while allowing crystal contacts is often a trial-and-error process.

  • Conformational heterogeneity: lgt likely adopts multiple conformations during its catalytic cycle, which can hinder crystallization.

  • Crystal packing: The presence of detergent micelles can interfere with crystal contact formation.

Table 4: Strategies to Overcome Crystallization Challenges

ChallengeStrategyImplementation Details
Protein stabilityThermostabilizing mutationsIdentify and introduce point mutations that increase thermal stability without affecting function
Detergent selectionSystematic screeningTest a panel of detergents including DDM, LMNG, CYMAL-7, and GDN
Conformational heterogeneityLigand or inhibitor complexesCo-crystallize with substrate analogs or inhibitors to trap specific conformational states
Crystal packingAntibody fragment co-crystallizationGenerate Fab fragments against lgt to provide additional crystal contact surfaces
Detergent interferenceLipidic cubic phase (LCP) crystallizationAttempt crystallization in lipidic mesophases which can better mimic the membrane environment

Additional approaches could include:

  • Using protein fusion partners like BRIL or T4 lysozyme inserted into loops to increase polar surface area

  • Employing surface entropy reduction by mutating clusters of high-entropy residues (e.g., Lys, Glu) to alanines

  • Exploring nanodiscs or amphipols as alternatives to traditional detergents

  • Attempting crystallization with lipids that might stabilize specific conformations

How can molecular dynamics simulations be effectively used to study Shigella boydii serotype 4 lgt catalytic mechanism?

Molecular dynamics (MD) simulations offer powerful insights into the dynamics and mechanisms of enzymes like lgt. For Shigella boydii serotype 4 lgt, the following approach would be most effective:

  • Model construction:

    • Build a homology model based on available lgt structures (e.g., from E. coli) using software like MODELLER or SWISS-MODEL

    • Embed the model in a realistic membrane bilayer containing phosphatidylglycerol, phosphatidylethanolamine, and cardiolipin at physiologically relevant ratios

    • Solvate the system with explicit water molecules and add counterions to neutralize the system

  • Simulation setup:

    • Perform energy minimization followed by equilibration in multiple phases (position restraints gradually released)

    • Run production simulations at physiological temperature (310K) for sufficient sampling (minimum 500 ns, ideally multiple microseconds)

    • Use specialized MD packages optimized for membrane proteins (e.g., GROMACS, NAMD, or AMBER with appropriate lipid force fields)

  • Specific simulation scenarios:

    • Apo enzyme dynamics to identify conformational changes and potential binding sites

    • Substrate binding simulations with docked phosphatidylglycerol and preprolipoprotein substrates

    • Free energy calculations (e.g., umbrella sampling) to map the energy landscape of the reaction

    • Steered MD to investigate pathways for substrate entry and product exit

  • Analysis approaches:

    • Principal component analysis to identify major conformational motions

    • Hydrogen bond and salt bridge analysis to identify key interactions

    • Water density and channel analysis to track solvent accessibility

    • Contact analysis between enzyme, substrates, and products throughout the reaction coordinate

For the most accurate results, consider enhanced sampling techniques such as replica exchange MD or metadynamics to overcome energy barriers and sample rare events that might be important for the catalytic mechanism.

What are the most effective approaches for developing selective inhibitors of Shigella boydii serotype 4 lgt?

Development of selective inhibitors for Shigella boydii serotype 4 lgt requires a multidisciplinary approach combining structural biology, computational methods, and medicinal chemistry. A comprehensive inhibitor development workflow would include:

  • Target validation and assay development:

    • Confirm essentiality of lgt in Shigella boydii serotype 4 through genetic approaches

    • Develop robust, high-throughput assays for screening (e.g., the luciferase-coupled assay mentioned earlier)

    • Establish secondary assays to confirm target engagement

  • Structure-based approaches:

    • Utilize homology models or experimental structures (X-ray crystallography or cryo-EM)

    • Identify potentially druggable binding sites, focusing on the catalytic site and substrate entry pathways

    • Perform virtual screening of compound libraries against these sites

    • Design targeted fragment libraries for experimental screening

  • Fragment-based drug discovery:

    • Screen fragment libraries using biophysical methods (thermal shift assays, STD-NMR, surface plasmon resonance)

    • Identify hit fragments that bind to lgt

    • Use structural information to guide fragment growing, linking, or merging strategies

  • Medicinal chemistry optimization:

    • Establish structure-activity relationships (SAR)

    • Optimize for potency, selectivity, membrane permeability, and metabolic stability

    • Focus on physicochemical properties suitable for compounds targeting Gram-negative bacteria

  • Selectivity considerations:

    • Design inhibitors that exploit unique features of Shigella boydii serotype 4 lgt compared to human enzymes

    • Test against a panel of related bacterial lgt enzymes to assess spectrum of activity

    • Evaluate potential for resistance development

Table 5: Potential Inhibitor Scaffolds Based on lgt Mechanism

Inhibitor TypeTarget SiteDesign RationalePotential AdvantagesDevelopment Challenges
Substrate analogsActive siteMimic phosphatidylglycerol structureWell-defined binding interactionsLipid-like properties may limit bioavailability
Transition state mimicsCatalytic centerStabilize reaction intermediate structuresPotentially high affinityComplex synthesis
Allosteric inhibitorsConformational control sitesPrevent conformational changes needed for catalysisPotentially higher selectivityIdentifying suitable allosteric sites
Covalent inhibitorsCatalytic histidineForm irreversible bond with key catalytic residueExtended residence timePotential off-target reactivity
Peptide-based inhibitorsSubstrate binding cleftMimic preprolipoprotein substrateExploit protein-protein interaction surfaceCell penetration challenges

For Shigella-specific development, comparing sequences and models across different Shigella species and serotypes would be valuable to identify unique features that could be exploited for selective targeting .

How might recombinant Shigella boydii serotype 4 lgt be utilized in vaccine development strategies?

Recombinant Shigella boydii serotype 4 lgt holds potential for novel vaccine development strategies through several approaches:

  • Attenuated live vaccine development:

    • Creating lgt-deficient or conditionally attenuated Shigella boydii strains with regulated lgt expression could provide live vaccine candidates

    • These strains might maintain immunogenicity while showing reduced virulence due to impaired lipoprotein processing

    • Challenge studies in animal models would be needed to assess protection levels and safety profiles

  • Subunit vaccine components:

    • Recombinant lgt itself is unlikely to be a protective antigen, but it could be used to generate properly modified lipoproteins as vaccine components

    • In vitro lipidation systems using purified lgt could produce lipidated antigens with enhanced immunogenicity

    • The lipidated antigens would engage TLR2, providing an intrinsic adjuvant effect

  • Understanding antigen presentation:

    • Studying how lgt-modified lipoproteins are recognized by the immune system could inform better vaccine design

    • Investigation of how these modifications affect antigen processing and presentation to both innate and adaptive immune components

    • Comparative studies of immune responses to wild-type versus lgt-modified surface antigens

Research priorities should include identifying immunodominant Shigella boydii serotype 4 lipoproteins, characterizing their immunological properties when correctly processed by lgt, and determining how modifications in lipoprotein processing affect protective immunity against urinary tract and gastrointestinal infections .

What are the implications of Shigella boydii serotype 4 lgt research for understanding extraintestinal Shigella infections?

Research on Shigella boydii serotype 4 lgt has significant implications for understanding the mechanisms underlying extraintestinal Shigella infections, particularly rare but documented urinary tract infections:

  • Tissue tropism determinants:

    • Properly processed lipoproteins may contribute to the ability of certain Shigella strains to colonize extraintestinal sites

    • Comparison of lipoprotein profiles between intestinal-restricted and extraintestinal-capable strains could reveal key factors

    • Investigation of how lgt-processed lipoproteins interact with different host tissue types

  • Immune evasion strategies:

    • Different environments (intestinal versus urinary tract) present distinct immune challenges

    • Lipoproteins may play roles in evading tissue-specific immune responses

    • Understanding how lgt-dependent lipoprotein modifications affect recognition by innate immune receptors in different tissues

  • Metabolic adaptations:

    • Properly processed lipoproteins include nutrient transporters and metabolic enzymes

    • These may enable adaptation to different nutritional environments outside the intestine

    • Comparative functional studies of lgt activity under conditions mimicking different infection sites

  • Diagnostic and therapeutic implications:

    • Identification of serotype-specific lipoprotein markers that could improve diagnosis of extraintestinal Shigella infections

    • Development of targeted therapies that could prevent dissemination without disturbing gut microbiota

As reported by Papasian et al., urinary tract infections with Shigella species are uncommon, and those caused by Shigella sonnei are particularly unusual, suggesting unique adaptive requirements for this ecological niche . Understanding how lgt contributes to these adaptations could provide valuable insights into bacterial niche adaptation mechanisms.

What are the most significant knowledge gaps in our understanding of Shigella boydii serotype 4 lgt?

Despite advances in bacterial lipoprotein processing research, several significant knowledge gaps remain regarding Shigella boydii serotype 4 lgt:

  • Serotype-specific variations: The extent to which lgt structure, function, and substrate specificity might differ between Shigella boydii serotype 4 and other Shigella species or serotypes remains largely unexplored. These differences could have implications for pathogenesis and therapeutic targeting.

  • Role in pathogenesis: While lgt is essential in Gram-negative bacteria, its specific contributions to Shigella boydii virulence mechanisms, particularly in extraintestinal infections like urinary tract infections, are not fully characterized. The identities and functions of key lipoproteins processed by lgt during different stages of infection remain to be elucidated.

  • Regulation mechanisms: How expression and activity of lgt are regulated in response to different environmental conditions encountered during infection (e.g., pH changes, nutrient availability, host defense molecules) is poorly understood.

  • Interaction with host factors: The interactions between lgt-processed lipoproteins and host receptors or defense mechanisms in different tissues, including the urinary tract, require further investigation to understand tissue tropism and immune evasion strategies.

  • Inhibitor development: Despite the potential of lgt as an antimicrobial target, development of selective inhibitors remains challenging, particularly regarding specificity, membrane permeability, and resistance mechanisms.

Addressing these knowledge gaps through integrated structural, biochemical, genetic, and immunological approaches will advance our understanding of Shigella pathogenesis and potentially reveal new therapeutic strategies for both intestinal and extraintestinal Shigella infections.

How can interdisciplinary approaches advance research on recombinant Shigella boydii serotype 4 lgt?

Advancing research on recombinant Shigella boydii serotype 4 lgt requires integration of multiple scientific disciplines to address its complex biology and potential applications:

  • Structural biology and biophysics:

    • Cryo-electron microscopy and X-ray crystallography to determine high-resolution structures

    • Advanced spectroscopic methods (NMR, EPR) to characterize dynamics and conformational changes

    • Single-molecule techniques to observe enzyme function in real-time

  • Computational biology:

    • Molecular dynamics simulations to understand catalytic mechanisms

    • Machine learning approaches for inhibitor design and prediction of substrate specificity

    • Systems biology modeling to understand lgt's role in cellular networks

  • Chemical biology:

    • Development of activity-based probes for tracking lgt activity in live cells

    • Photoaffinity labeling to capture transient enzyme-substrate complexes

    • Click chemistry approaches for monitoring lipoprotein processing in situ

  • Immunology and infection biology:

    • Investigation of how lgt-processed lipoproteins interact with host immune receptors

    • Animal models to study the role of lgt in different infection contexts

    • Host-pathogen interaction studies focused on lipoproteins at tissue interfaces

  • Synthetic biology:

    • Engineered expression systems for high-yield production of functional recombinant lgt

    • Development of minimal reconstituted systems for lipoprotein processing

    • Creation of reporter strains for monitoring lgt activity during infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.