Recombinant Shigella boydii serotype 4 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Shigella boydii serotype 4 Protein CrcB homolog (crcB) is a protein expressed by the crcB gene in Shigella boydii serotype 4 . Shigella boydii is a species of bacteria that causes shigellosis, an infectious disease also known as bacillary dysentery, which leads to diarrhea .

Characteristics

CharacteristicDescription
OrganismShigella boydii serotype 4 (strain Sb227)
Gene NamecrcB
Protein NameProtein CrcB homolog
UniProt Accession No.Q324R8
AA SequencemLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH
Molecular Functionsequence-specific DNA binding
Expression Region1-127
SourceE. coli

Function and Research

Shigella boydii is one of the serotypes of Shigella bacteria prevalent in areas like Bangladesh . The World Health Organization (WHO) recognizes Shigella as a priority for research and development of new drugs because of its impact on public health .

Studies on Shigella often involve identifying and characterizing its various serotypes, because immunity to Shigella is serotype-specific . One study isolated a novel phage, MK-13, which specifically lyses S. boydii type 1 but does not lyse other serotypes of Shigella or other enteric bacteria tested . The study also showed the prevalence of 20 different serotypes of S. boydii in Bangladesh and diagnosis of S. boydii serotypes without using antisera .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; SBO_0489; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: sbo:SBO_0489

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant Shigella boydii CrcB protein?

Based on established protocols for the recombinant protein :

Storage ParameterRecommended ConditionNotes
Short-term storage4°CViable for up to one week
Long-term storage-20°CStandard storage condition
Extended storage-80°CFor maximum stability
Buffer compositionTris-based buffer with 50% glycerolOptimized for this specific protein
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended

Methodological considerations:

  • Always use sterile technique when handling protein aliquots

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

  • When thawing, place on ice and use immediately for experiments

  • For experimental use, dilute in appropriate buffers immediately before use

  • Check protein activity periodically if stored for extended periods

How is the recombinant Shigella boydii CrcB protein typically produced and purified for research?

Production and purification of the recombinant CrcB homolog typically follows these methodological steps:

Expression System Selection:

  • E. coli BL21(DE3) or similar expression strains are commonly used

  • Selection of appropriate expression vector with affinity tag (typically His-tag as indicated in product specifications )

  • Temperature optimization during induction phase (typically 16-30°C)

Expression Protocol:

  • Transform expression vector containing the crcB gene into competent E. coli cells

  • Culture in appropriate media (LB or similar) with selective antibiotics

  • Induce protein expression at optimal OD600 (typically 0.6-0.8) using IPTG

  • Continue expression for determined time period (3-16 hours depending on protein stability)

Purification Strategy:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • On-column refolding if necessary

  • Elution with imidazole gradient

  • Dialysis into storage buffer (Tris-based with 50% glycerol as per specifications )

  • Quality control by SDS-PAGE and western blotting

Similar approaches have been successfully employed for other Shigella proteins, such as the α domain of VirG , which was expressed in E. coli with yields of 6.2 mg/L culture, >95% purity, and <1% residual host-cell proteins.

How does the genomic context of the crcB gene in Shigella boydii serotype 4 compare with other Shigella species?

The crcB gene in S. boydii serotype 4 is designated by the ordered locus name SBO_0489 . Comparative genomic analysis reveals interesting patterns:

Species/StraincrcB Genomic ContextNotable Features
S. boydii serotype 4SBO_0489Full-length functional CrcB homolog
S. boydii (other serotypes)Variable presenceS. boydii exists in three distinct clades with different gene content
S. flexneriPresent in most strainsTypically maintains high sequence conservation
S. sonneiPresent in most strainsTypically less genomic diversity than other species
S. dysenteriaeVariable presenceOften with higher mutation rates

Genomic analysis of S. boydii has revealed that the species consists of three distinct phylogenetic clades, with clade 1 being the most divergent and containing 98 unique genes compared to only 4 and 12 unique genes in clades 2 and 3, respectively . The genetic diversity within S. boydii is particularly significant given that the average genome size is approximately 4,397,328 bp with a GC content of around 50.75% .

Methodological approach for comparative genomic analysis:

  • Whole genome sequencing using next-generation sequencing platforms

  • Alignment using tools like Mugsy algorithm for reference-independent comparison

  • Phylogenomic analysis using RAxML or similar tools

  • Protein coding gene comparison using large-scale BLAST score ratio (LS-BSR) analysis

  • Identification of clade-specific genes and their functions

What experimental approaches can be used to characterize the ion channel properties of Shigella boydii CrcB protein?

As a putative ion channel, several specialized methodologies can be employed to characterize the functional properties of the CrcB homolog:

1. Electrophysiological Methods:

  • Planar lipid bilayer recordings to measure single-channel conductance

  • Patch-clamp analysis of cells expressing recombinant CrcB

  • Ion flux measurements using fluorescent probes (e.g., PBFI for fluoride)

2. Fluoride Sensitivity Assays:

  • Growth inhibition assays with varying fluoride concentrations

  • Complementation studies in crcB knockout strains

  • Fluoride uptake assays using radioactive 18F or fluoride-sensitive probes

3. Structural Analysis:

  • Cryo-electron microscopy to determine membrane protein structure

  • X-ray crystallography (though challenging for membrane proteins)

  • NMR spectroscopy for dynamic structural information

4. Computational Approaches:

  • Molecular dynamics simulations to model ion conductance

  • Homology modeling based on related ion channel structures

  • In silico docking to identify potential inhibitors or modulators

5. Mutagenesis Studies:

  • Alanine scanning mutagenesis to identify key residues

  • Cysteine accessibility methods to map the pore structure

  • Chimeric constructs with other CrcB homologs to determine domain functions

These approaches can be combined with bacterial viability and pathogenicity assays to link channel function with bacterial survival under various conditions, similar to strategies used in studying other Shigella membrane proteins.

How can recombinant Shigella boydii CrcB protein be used in vaccine development research?

While CrcB homolog itself has not been specifically identified as a vaccine candidate in the literature, research approaches using recombinant Shigella proteins provide a framework for such investigations:

Antigen Potential Assessment:

  • Epitope mapping of CrcB to identify potential B-cell and T-cell epitopes

  • Surface accessibility analysis (CrcB is a membrane protein with potentially accessible extracellular domains)

  • Conservation analysis across Shigella serotypes and strains

Immunogenicity Studies:

  • Evaluation of immune responses in animal models using purified recombinant CrcB

  • Analysis of antibody titers using ELISA

  • Assessment of cellular immune responses via ELISpot or flow cytometry

Vaccine Formulation Approaches:

  • Subunit vaccine approach using purified CrcB or epitope-derived peptides

  • Adjuvant selection for optimal immune response

  • Delivery systems (e.g., liposomes, virus-like particles)

Lessons from successful Shigella vaccine research, such as work with the VirG protein, can inform CrcB studies. For example, VirG α domain (VirGα) has shown promise as a cross-protective vaccine candidate against multiple Shigella serotypes . When administered intramuscularly with alum, VirGα elicited robust immune responses and high protective efficacy against both S. flexneri 2a and S. sonnei. Almost complete protection was achieved when VirGα was given intranasally with E. coli double mutant heat-labile toxin (dmLT) .

ApproachAdvantagesChallenges
Surface-exposed epitopesDirect antibody accessibilityLimited exposure of membrane proteins
Conserved epitopesCross-protection potentialPotentially less immunogenic
Combination with other antigensBroader protectionPotential antigenic competition
Live attenuated vectors expressing CrcBStrong cellular immunitySafety concerns

What roles does the CrcB homolog potentially play in Shigella boydii pathogenesis and stress response?

While specific information about the role of CrcB in S. boydii pathogenesis is limited, we can analyze its potential functions based on current understanding of Shigella pathogenesis and related bacterial systems:

Potential Roles in Pathogenesis:

Methodological Approaches to Study These Roles:

  • Gene Knockout Studies:

    • Generate crcB deletion mutants using techniques similar to those described for other Shigella genes

    • Assess impact on growth, survival, and virulence in various conditions

  • Transcriptional Analysis:

    • Quantify crcB expression during infection using RT-qPCR

    • RNA-seq to identify co-regulated genes under stress conditions

  • In Vivo Infection Models:

    • Compare wild-type and crcB mutant strains in animal models

    • Assess colonization, persistence, and pathological outcomes

  • Cell Culture Assays:

    • Invasion assays using epithelial cell lines

    • Survival within macrophages

For context, other Shigella proteins like VirG (IcsA) are known to be essential for bacterial pathogenesis. VirG mediates actin-based motility and IcsB prevents autophagy, allowing Shigella to spread efficiently within host tissues . Understanding whether and how CrcB contributes to these processes would be valuable.

How can bioinformatic approaches be used to predict functional interactions of the Shigella boydii CrcB protein?

Bioinformatic analyses can provide valuable insights into potential functional interactions of the CrcB homolog:

Protein-Protein Interaction Prediction:

  • Sequence-based methods (co-evolution analysis, domain-domain interaction predictions)

  • Structure-based approaches (docking simulations, interface predictions)

  • Network-based methods (functional association networks, gene neighborhood analysis)

Comparative Genomic Approaches:

  • Phylogenetic profiling to identify co-occurring genes across genomes

  • Synteny analysis to identify conserved gene neighborhoods

  • Operon prediction to identify potentially co-regulated genes

Functional Annotation Transfer:

  • Ortholog identification and functional annotation transfer

  • Domain-based function prediction

  • Gene Ontology (GO) term enrichment analysis

Implementation Strategy:

Analysis StepToolsExpected Outputs
Homology detectionBLAST, HHpred, HMMERIdentification of related proteins with known functions
Structural modelingAlphaFold2, I-TASSER, Phyre23D structure predictions
Functional domain analysisInterProScan, Pfam, SMARTIdentification of functional domains and motifs
Protein-protein interactionSTRING, IntAct, STITCHPrediction of interaction partners
Genomic context analysisMicrobesOnline, SyntTax, FgenesBIdentification of genomic neighborhoods
Evolutionary analysisMEGA, PhyML, MrBayesPhylogenetic relationships with other CrcB proteins

These bioinformatic approaches can guide experimental design by generating testable hypotheses about CrcB function in S. boydii. For example, if genomic context analysis reveals co-localization with stress response genes, this would suggest a role in stress adaptation that could be experimentally validated.

The genomic diversity observed within S. boydii (consisting of three major clades with different gene content) highlights the importance of comparative genomic approaches for understanding the function and evolution of proteins like CrcB.

What challenges exist in producing functional recombinant membrane proteins like Shigella boydii CrcB, and how can these be addressed?

Membrane proteins like CrcB present unique challenges in recombinant expression and purification:

Common Challenges and Solutions:

  • Low Expression Levels:

    • Optimization of codon usage for expression host

    • Use of specialized expression vectors with strong but controllable promoters

    • Testing multiple expression hosts (E. coli C41/C43, Pichia pastoris, insect cells)

    • Fusion tags to enhance expression (MBP, SUMO, Mistic)

  • Protein Misfolding and Aggregation:

    • Expression at lower temperatures (16-25°C)

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Addition of chemical chaperones to growth media

    • Optimization of induction conditions (IPTG concentration, OD at induction)

  • Toxicity to Host Cells:

    • Use of tightly regulated inducible systems

    • Leak-free expression systems (T7 lysozyme co-expression)

    • Cell-free expression systems

  • Solubilization and Purification:

    • Screening different detergents (DDM, LDAO, Fos-choline)

    • Use of styrene maleic acid lipid particles (SMALPs)

    • Nanodisc technology for maintaining native-like lipid environment

    • Optimization of purification buffers and conditions

Experimental Design Framework:

StageOptimization StrategyAnalytical Methods
ExpressionTest multiple hosts, vectors, and conditionsSDS-PAGE, Western blot, GFP fusion tracking
Membrane extractionDetergent screening, gentle lysis methodsLight scattering, protein quantification
PurificationIMAC, size exclusion, ion exchangeSDS-PAGE, Western blot, activity assays
Functional validationReconstitution into liposomes or nanodiscsFluoride transport assays, structural analysis

Case Study Approach:
Recent work with membrane proteins from related bacteria can guide S. boydii CrcB expression strategies. For example, successful expression and purification of VirG protein from Shigella required optimization of E. coli expression systems, with specific attention to refolding conditions . Similar approaches could be applied to CrcB, with adaptations for its membrane protein nature.

How does the genetic diversity of Shigella boydii impact research on specific proteins like CrcB?

The genetic diversity of S. boydii has significant implications for research on specific proteins:

Genetic Diversity of S. boydii:
Genome analysis has revealed that S. boydii exists in three distinct phylogenetic clades with significant genetic differences :

  • Clade 1 contains 98 unique genes not found in clades 2 and 3

  • Clades 2 and 3 have only 4 and 12 unique genes, respectively

  • The average S. boydii genome size is approximately 4,397,328 bp with a GC content of around 50.75%

Implications for CrcB Research:

  • Sequence Variation:

    • Potential variations in the crcB gene sequence across different S. boydii clades

    • Impacts on protein structure, function, and regulation

  • Expression Patterns:

    • Variations in promoter regions may affect expression levels

    • Differential regulation in different genetic backgrounds

  • Functional Relevance:

    • Potential adaptation to different ecological niches

    • Role in specific pathogenicity mechanisms

Methodological Considerations:

  • Sampling Strategy:

    • Inclusion of strains from different clades in research studies

    • Phylogenetic characterization of strains used in functional studies

  • Comparative Analysis:

    • Sequence alignment of crcB genes from different S. boydii strains

    • Functional comparison of CrcB proteins from different clades

  • Standardization Approaches:

    • Use of reference strains from each clade

    • Development of clade-specific primers and antibodies

The large-scale BLAST score ratio (LS-BSR) analysis approach used to compare protein-encoding genes between S. boydii genomes could be specifically applied to analyze the conservation and variation of the crcB gene across different isolates. This would provide insights into the evolutionary pressures on this gene and its functional importance across different genetic backgrounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.