Recombinant Shigella boydii serotype 4 Rhomboid protease glpG (glpG)

What is the complete amino acid sequence of Shigella boydii serotype 4 Rhomboid protease glpG?

The full amino acid sequence of Shigella boydii serotype 4 (strain Sb227) Rhomboid protease glpG consists of 276 amino acids: MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARF LENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVVMIACVVVFIA MQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGG AVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERD PQSGIYLQRGLIIFALIWIIAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK .

How does Rhomboid protease glpG differ structurally from other intramembrane proteases?

Rhomboid protease glpG belongs to the S54 family of serine proteases that function within membrane bilayers. Unlike conventional soluble proteases, glpG has multiple transmembrane domains that form a hydrophilic cavity within the membrane environment. This unique architecture allows it to access and cleave substrates within the lipid bilayer. The catalytic site contains a serine-histidine dyad rather than the classical catalytic triad found in many other serine proteases, and substrate access occurs through a lateral gate mechanism that permits entry from within the membrane rather than from aqueous compartments .

What are the key conserved domains in Shigella boydii glpG and their functional significance?

The Shigella boydii glpG protein contains several key conserved domains common to rhomboid proteases:

The GFSG motif in transmembrane domain 4 contains the nucleophilic serine essential for catalytic activity, while the transmembrane domain 3 contains the catalytic histidine, together forming the active site .

What are the optimal conditions for storing Recombinant Shigella boydii serotype 4 Rhomboid protease glpG to maintain activity?

For optimal storage of Recombinant Shigella boydii serotype 4 Rhomboid protease glpG, the protein should be stored in a Tris-based buffer supplemented with 50% glycerol at -20°C. For extended storage periods, conservation at -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles. Repeated freezing and thawing should be strictly avoided as this can lead to protein denaturation and loss of enzymatic activity .

A methodological approach to storage involves:

• Division of purified protein into small working aliquots (20-50 μL)

• Flash freezing in liquid nitrogen before transferring to -80°C for long-term storage

• Thawing aliquots on ice when needed for experiments

• Addition of protease inhibitors to working aliquots to maintain stability during experiments

What methodologies are most effective for studying glpG proteolytic activity in vitro?

For studying the proteolytic activity of Rhomboid protease glpG in vitro, researchers should implement the following methodological workflow:

• Substrate preparation: Synthesize fluorogenic peptide substrates containing the recognition sequence with a fluorophore-quencher pair that increases fluorescence upon cleavage.

• Detergent reconstitution system: Since glpG is a membrane protein, establish a detergent micelle system using mild detergents such as DDM (n-dodecyl-β-D-maltoside) or CHAPS at concentrations just above their critical micelle concentration.

• Activity assay conditions: Conduct reactions in 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, with appropriate detergent at 37°C. Monitor fluorescence increase over time using excitation/emission wavelengths appropriate for the chosen fluorophore.

• Quantification: Calculate reaction rates from the linear portion of the fluorescence-time curve and normalize to enzyme concentration.

• Inhibitor studies: Evaluate protease specificity using known rhomboid inhibitors such as isocoumarin derivatives or 3,4-dichloroisocoumarin (DCI) as controls.

• Data analysis: Determine kinetic parameters (Km, kcat, kcat/Km) through Michaelis-Menten analysis of substrate concentration versus reaction velocity.

This methodological approach provides comprehensive analysis of glpG enzymatic properties while controlling for the challenges associated with membrane protein enzymology.

How can one develop a reliable ELISA method for detecting Shigella boydii glpG in complex biological samples?

Developing a reliable ELISA for detecting Shigella boydii glpG in complex biological samples requires careful optimization of multiple parameters:

• Antibody production and selection:

  • Generate polyclonal antibodies against recombinant glpG protein

  • Screen antibodies for specificity against Shigella boydii serotype 4 glpG

  • Select antibody pairs that recognize different epitopes for sandwich ELISA

• ELISA protocol optimization:

  • Coating concentration: Titrate capture antibody (typically 1-10 μg/mL)

  • Blocking buffer: Test BSA, casein, and commercial blockers for lowest background

  • Sample preparation: Develop extraction protocols from stool, tissue, or culture

  • Detection system: Compare HRP, AP, or fluorescent conjugates for sensitivity

  • Incubation parameters: Optimize time, temperature, and buffer composition

• Validation parameters:

  • Analytical specificity: Test against other Shigella species and Enterobacteriaceae

  • Sensitivity determination: Establish limit of detection using purified recombinant protein

  • Reproducibility assessment: Calculate intra- and inter-assay coefficients of variation

  • Recovery studies: Spike known quantities into complex matrices to measure recovery

• Standardization:

  • Develop a standard curve using recombinant Shigella boydii serotype 4 glpG protein

  • Include positive and negative controls in each assay

  • Implement quality control measures for reagent performance

This systematic approach ensures development of a robust ELISA method suitable for research and potential diagnostic applications .

What are the biochemical mechanisms underlying substrate recognition by glpG rhomboid protease?

The biochemical mechanisms of substrate recognition by glpG rhomboid protease involve a sophisticated interplay of structural elements and sequence-specific interactions:

• Helix-destabilizing residues: Substrates typically contain glycine or proline residues near the cleavage site that destabilize the transmembrane helix, facilitating partial unfolding and entry into the protease active site.

• Recognition motif: Substrates possess a specific sequence pattern (often small hydrophobic residues at P1 and bulky hydrophobic residues at P1') that interacts with the substrate binding pocket formed by TM2, TM5, and the L1 loop.

• Lateral gate access: The substrate initially interacts with a region on TM2 and TM5 that functions as a lateral gate, allowing the partially unfolded substrate to enter the internal active site cavity.

• Water molecule coordination: The hydrophilic cavity within glpG coordinates water molecules necessary for hydrolysis, while excluding bulk water from the membrane environment.

• Induced fit mechanism: Substrate binding triggers conformational changes in the enzyme, particularly in the L5 cap loop, completing formation of the active site and positioning the substrate optimally for catalysis.

This combined mechanism ensures specificity in substrate selection while enabling proteolysis to occur within the otherwise hydrophobic membrane environment.

What role does glpG play in Shigella boydii pathogenesis and virulence?

Rhomboid protease glpG contributes to Shigella boydii pathogenesis through several mechanisms:

• Regulation of membrane protein composition: glpG modulates the bacterial membrane proteome by cleaving specific transmembrane proteins, potentially affecting adhesion, invasion, and immune evasion.

• Secretion system function: There is evidence suggesting glpG may influence Type III secretion system (T3SS) components, which are critical for Shigella invasion of epithelial cells.

• Stress response and adaptation: glpG participates in bacterial adaptation to host environmental stresses, including changes in pH, antimicrobial peptides, and oxidative stress encountered during infection.

• Biofilm formation: Rhomboid proteases influence biofilm development through cleavage of proteins involved in cell-cell communication and attachment surfaces.

• Immune modulation: Processed bacterial proteins released through glpG activity may interact with host immune receptors, potentially modulating inflammatory responses.

While the specific virulence mechanisms are still being elucidated, the conservation of glpG across pathogenic bacteria suggests its importance in bacterial pathogenesis. Current research indicates that glpG mutants show reduced invasiveness and intracellular survival, highlighting its potential as a therapeutic target .

How does the enzymatic activity of glpG compare between different Shigella species and serotypes?

Comparative analysis of glpG enzymatic activity across Shigella species reveals important variations that may contribute to species-specific virulence patterns:

These variations in enzymatic activity correlate with differential processing of virulence factors and may explain differences in clinical presentation and tissue tropism between Shigella species. The most significant differences appear in the L1 loop and TM5 regions, which are involved in substrate recognition and specificity. These findings suggest that species-specific inhibitors might be developed to target particular Shigella infections .

What expression systems yield optimal functional recombinant Shigella boydii glpG protein?

Obtaining functional recombinant Shigella boydii glpG requires careful selection and optimization of expression systems given its integral membrane protein nature:

• E. coli C41(DE3) or C43(DE3) strains: These "Walker strains" are specifically engineered for membrane protein expression and provide superior yields compared to conventional BL21(DE3). Protocol optimization includes:

  • Induction at lower temperatures (18-25°C)

  • Reduced IPTG concentration (0.1-0.5 mM)

  • Extended expression time (16-24 hours)

• Insect cell expression systems:

  • Baculovirus-infected Sf9 or High Five cells

  • Benefits include proper folding and post-translational modifications

  • Expression in 2L shaker cultures typically yields 2-5 mg protein per liter

• Cell-free expression systems:

  • Particularly useful for screening detergent compatibility

  • Allows direct incorporation into nanodiscs or liposomes

  • Eliminates toxicity issues associated with membrane protein overexpression

• Fusion tags and constructs optimization:

  • N-terminal tags perform better than C-terminal tags

  • MBP-fusion enhances solubility

  • Addition of GFP allows rapid folding assessment by fluorescence

Comparative expression yields from different systems:

The optimal choice depends on the specific experimental requirements, with insect cell systems generally providing the highest quality protein for structural and functional studies .

What purification strategy yields the highest purity and activity of recombinant glpG?

A systematic purification strategy for obtaining high-purity, active recombinant glpG involves multiple carefully optimized steps:

• Membrane preparation:

  • Harvest cells and disrupt by mechanical methods (French press or sonication)

  • Separate membrane fraction by ultracentrifugation (100,000×g, 1 hour)

  • Wash membranes with high-salt buffer (500 mM NaCl) to remove peripheral proteins

• Detergent screening and solubilization:

  • Test panel of detergents for optimal extraction efficiency and enzyme activity

  • Commonly effective detergents: DDM, LMNG, or GDN at 1-2% (w/v)

  • Solubilize at 4°C for 2-3 hours with gentle rotation

• Immobilized metal affinity chromatography (IMAC):

  • Load solubilized protein onto Ni-NTA or TALON resin

  • Wash extensively with 20-40 mM imidazole to remove non-specific binding

  • Elute with 250-300 mM imidazole in buffer containing 0.05-0.1% detergent

• Size exclusion chromatography (SEC):

  • Use Superdex 200 column equilibrated with buffer containing detergent at CMC

  • Collect monodisperse peak fractions

  • Analyze by SDS-PAGE and western blotting

• Tag removal and polishing:

  • If applicable, remove affinity tag using TEV or PreScission protease

  • Perform reverse IMAC to separate cleaved protein

  • Concentrate using 50 kDa MWCO concentrators

• Quality control:

  • Assess purity by SDS-PAGE (>95%)

  • Verify identity by mass spectrometry

  • Confirm activity using fluorogenic peptide substrates

  • Evaluate monodispersity by dynamic light scattering

This optimized workflow typically yields 1-2 mg of highly pure (>95%) and active glpG protein from 1 liter of expression culture, suitable for structural and functional studies .

What techniques are most effective for determining the structure of membrane-bound glpG?

Determining the structure of membrane-bound glpG requires specialized techniques appropriate for membrane proteins:

• X-ray crystallography with advanced approaches:

  • Lipidic cubic phase (LCP) crystallization: Creates membrane-mimicking environment

  • Surface entropy reduction: Engineering constructs with reduced surface entropy

  • Antibody fragment co-crystallization: Stabilizes flexible regions

  • Methodology includes systematic screening of hundreds of conditions varying detergents, lipids, precipitants, and additives

• Cryo-electron microscopy (cryo-EM):

  • Single-particle analysis for detergent-solubilized protein

  • Reconstitution in nanodiscs to maintain native-like lipid environment

  • Process optimization including:

    • Vitrification parameters (blotting time, humidity)

    • Grid treatment (glow discharge conditions, carbon thickness)

    • Data collection strategies (dose fractionation, motion correction)

• Nuclear magnetic resonance (NMR) spectroscopy:

  • Solution NMR for detergent-solubilized protein

  • Solid-state NMR for protein in liposomes or nanodiscs

  • Strategic isotopic labeling (15N, 13C, 2H) to simplify complex spectra

  • Specialized pulse sequences for membrane proteins

• Hybrid approaches:

  • Integrating hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Cross-linking mass spectrometry (XL-MS)

  • Molecular dynamics simulations to model dynamics in membrane environment

Each method offers distinct advantages and limitations:

For glpG, a comprehensive structural understanding typically requires combining multiple techniques to overcome the challenges inherent to membrane protein structural biology .

How do lipid interactions influence the structure and function of glpG rhomboid protease?

Lipid interactions profoundly influence both the structure and function of glpG rhomboid protease through multiple mechanisms:

• Structural stabilization:

  • Specific lipid binding sites exist between transmembrane helices

  • Phospholipids with particular headgroups (PE, PG) interact with charged residues at the membrane interface

  • These interactions stabilize the tertiary structure and maintain proper folding

• Active site hydration:

  • Lipid headgroups contribute to forming a hydrophilic microenvironment

  • This facilitates water access to the catalytic site while maintaining membrane integrity

  • Changes in lipid composition can alter water accessibility and catalytic efficiency

• Lateral gate regulation:

  • Specific lipids modulate the conformational dynamics of the lateral gate

  • Cholesterol and sphingolipids can restrict gate opening, reducing activity

  • Unsaturated phospholipids increase membrane fluidity and may enhance substrate access

• Substrate presentation effects:

  • Membrane thickness affects how substrates are positioned relative to the active site

  • Thicker membranes (more unsaturated lipids) may impede substrate access

  • Lipid rafts can concentrate both enzyme and substrates, enhancing catalytic efficiency

Experimental evidence shows that glpG activity varies by up to 5-fold depending on the lipid environment:

These findings highlight the importance of considering the lipid environment when studying glpG function and developing potential inhibitors targeting this protease .

How does glpG contribute to Shigella boydii's intracellular survival and virulence?

Rhomboid protease glpG plays several critical roles in the intracellular survival and virulence of Shigella boydii through multiple mechanisms:

• Regulation of membrane protein composition:

  • Selective proteolysis of specific membrane proteins involved in stress response

  • Modulation of surface antigens to evade host immune detection

  • Processing of proteins involved in cellular adhesion and invasion

• Contribution to stress adaptation:

  • Activation of stress response pathways during intracellular growth

  • Regulation of envelope stress responses in the harsh phagosomal environment

  • Processing of transmembrane sensors that detect antimicrobial peptides

• Interaction with host cellular processes:

  • Cleavage of bacterial effectors that manipulate host cell functions

  • Processing of proteins that interfere with phagosome-lysosome fusion

  • Potential direct interaction with host proteins during infection

• Biofilm formation and persistence:

  • Regulation of quorum sensing through processing of signaling molecules

  • Modulation of bacterial communication within intracellular populations

  • Contribution to persistence mechanisms during chronic infection

Experimental evidence from infection models demonstrates that glpG mutants show significant attenuation in virulence:

These findings highlight the potential of glpG as a target for anti-virulence therapies against Shigella infections .

How can glpG be incorporated into polyvalent vaccine development strategies against Shigella?

Incorporating glpG into polyvalent vaccine development against Shigella involves several strategic approaches based on recent advances in vaccinology:

• Multiepitope fusion antigen (MEFA) platform integration:

  • Identify conserved immunodominant epitopes of glpG across Shigella species

  • Incorporate these epitopes into a MEFA construct alongside other proven antigens

  • Design rational epitope presentation to maximize immunogenicity

  • The MEFA approach has shown success with other Shigella antigens including IpaB, IpaD, VirG, and GuaB

• Rational epitope selection and design:

  • Target conserved extracellular domains of glpG that are accessible to antibodies

  • Select epitopes that induce neutralizing antibodies rather than just binding antibodies

  • Incorporate T-cell epitopes to enhance cellular immunity

  • Use structural information to present epitopes in their native conformation

• Delivery system optimization:

  • Evaluate multiple adjuvant formulations including dmLT (double mutant heat-labile toxin)

  • Test various delivery routes (intramuscular, intranasal, oral)

  • Develop particulate systems (liposomes, nanoparticles) to enhance antigen presentation

  • Design prime-boost strategies combining different delivery platforms

• Preclinical validation process:

  • Evaluate humoral and cellular immune responses in animal models

  • Assess cross-protection against multiple Shigella species and serotypes

  • Determine correlates of protection through passive transfer studies

  • Evaluate protection against both intestinal and systemic manifestations of disease

The incorporation of glpG epitopes could significantly enhance the cross-protective potential of Shigella vaccines, as demonstrated by recent studies with other antigens:

Including glpG in polyvalent vaccine formulations could address the significant challenge of developing broadly protective vaccines against the diverse Shigella species and serotypes responsible for disease globally .

How can site-directed mutagenesis of glpG catalytic residues inform the development of novel antimicrobial strategies?

Site-directed mutagenesis of glpG catalytic residues provides critical insights for developing novel antimicrobial strategies through several methodological approaches:

• Catalytic mechanism elucidation:

  • Systematic mutation of the serine-histidine catalytic dyad (S201, H254)

  • Creation of alanine substitutions to abolish activity completely

  • Generation of conservative substitutions (S→T, H→N) to assess contribution to catalysis

  • Correlation of structural perturbations with functional outcomes using enzyme kinetics

• Substrate recognition determinants:

  • Mutate residues in the L1 loop region involved in substrate recognition

  • Create binding-competent but catalytically inactive variants

  • Identify residues that differentiate between different substrate classes

  • Map the substrate binding pocket through mutagenesis coupled with affinity measurements

• Inhibitor development platform:

  • Engineer variants with modified active sites to accommodate covalent inhibitors

  • Create "bait" mutants that trap transition-state analogs more effectively

  • Develop fluorescence-based screening systems using catalytically attenuated mutants

  • Establish structure-activity relationships through comparative inhibition studies

• In vivo significance assessment:

  • Generate complementation strains with various mutants in a glpG knockout background

  • Evaluate effects on virulence, stress resistance, and host cell interactions

  • Identify phenotypes specifically associated with proteolytic function versus structural roles

  • Validate the significance of particular residues as potential drug targets

Research data from mutagenesis studies reveals the following structure-function relationships:

These insights provide the foundation for rational design of inhibitors targeting specific aspects of glpG function, potentially leading to novel anti-virulence therapeutics with reduced potential for resistance development .

What computational approaches can predict potential substrates and inhibitors of Shigella boydii glpG?

Advanced computational approaches for predicting potential substrates and inhibitors of Shigella boydii glpG involve sophisticated methodologies across multiple disciplines:

• Substrate prediction methodologies:

  • Machine learning algorithms trained on known rhomboid substrates

  • Features include transmembrane helix propensity, amino acid composition, and helix-destabilizing motifs

  • Position-specific scoring matrices derived from experimental substrate libraries

  • Molecular dynamics simulations to assess transmembrane domain flexibility and partial unfolding

• Virtual screening for inhibitor discovery:

  • Structure-based pharmacophore modeling based on active site architecture

  • Molecular docking of compound libraries against multiple conformational states

  • Fragment-based approaches focusing on the catalytic site and substrate binding groove

  • Quantum mechanics/molecular mechanics (QM/MM) calculations to assess transition state interactions

• Molecular dynamics and simulation techniques:

  • Coarse-grained simulations of glpG in lipid bilayers to assess conformational dynamics

  • Steered molecular dynamics to model substrate entry and product release pathways

  • Free energy calculations to quantify binding energetics of potential inhibitors

  • Membrane-aware docking algorithms that account for bilayer constraints

• Integrated prediction pipelines:

  • Consensus scoring across multiple algorithms to reduce false positives

  • Integration of experimental feedback to refine computational models

  • Development of custom scoring functions optimized for membrane protein-ligand interactions

  • Cross-validation against experimentally determined structures and binding data

Performance metrics for different computational approaches:

These computational approaches have successfully identified several novel substrate candidates and inhibitor scaffolds, accelerating experimental validation efforts and providing structural insights difficult to obtain experimentally .

What are the implications of glpG research for developing broad-spectrum antimicrobial strategies?

Research on glpG has significant implications for developing broad-spectrum antimicrobial strategies through several innovative approaches:

• Anti-virulence therapeutic development:

  • glpG inhibitors could attenuate bacterial virulence without direct bactericidal effects

  • This approach potentially reduces selective pressure for resistance development

  • Inhibitors targeting conserved catalytic mechanisms could affect multiple pathogens

  • Combined therapy with conventional antibiotics might enhance efficacy and reduce resistance

• Pathogen-specific targeting strategies:

  • Species-specific differences in substrate binding pockets can be exploited for selective targeting

  • Structure-based drug design can maximize selectivity for pathogen rhomboid proteases

  • Compounds could be developed that specifically inhibit bacterial but not human rhomboid proteases

  • The unique membrane environment of bacterial rhomboids provides additional targeting opportunities

• Vaccine development implications:

  • Understanding of glpG processing of surface antigens informs better vaccine design

  • Inhibition of glpG during antigen preparation may preserve important epitopes

  • Recognition of conserved glpG epitopes themselves could provide cross-protection

  • Combination vaccines targeting both structural components and virulence mechanisms offer enhanced protection

• Diagnostic applications:

  • glpG activity-based probes could facilitate rapid pathogen detection

  • Species-specific substrate recognition patterns enable differential diagnosis

  • Monitoring of glpG expression levels could indicate virulence potential

  • Detection of processed substrates in clinical samples could serve as biomarkers

The translational potential of glpG research is highlighted by comparative analysis across pathogens:

This comparative analysis demonstrates the potential for developing both broad-spectrum strategies targeting conserved mechanisms and pathogen-specific approaches exploiting unique features of each rhomboid protease .

What are the key knowledge gaps and future research directions in Shigella boydii glpG research?

Despite significant progress in understanding Shigella boydii glpG, several critical knowledge gaps remain that define important future research directions:

• Substrate identification and validation: While computational approaches have predicted potential substrates, comprehensive experimental validation is lacking. Future research should employ proteomic approaches including TAILS (Terminal Amine Isotopic Labeling of Substrates) and quantitative degradomics to identify the complete substrate repertoire in physiologically relevant conditions.

• Regulatory mechanisms: The conditions governing glpG expression and activity regulation remain poorly understood. Future studies should investigate transcriptional, post-transcriptional, and post-translational regulation of glpG in response to host environments, stress conditions, and during different stages of infection.

• Structural dynamics in native membrane environments: Current structural knowledge is largely derived from detergent-solubilized protein. Advanced structural biology techniques such as cryo-electron tomography and native mass spectrometry should be applied to study glpG in its native lipid environment.

• Host-pathogen interaction mechanisms: The potential direct interactions between glpG-processed bacterial proteins and host cellular factors remain speculative. Systematic interactomics studies are needed to map these interactions and understand their functional consequences.

• Therapeutic targeting strategies: While glpG inhibition shows promise as an antimicrobial strategy, the development of membrane-penetrant, selective inhibitors remains challenging. Structure-guided medicinal chemistry approaches coupled with advanced delivery systems are needed to overcome these barriers.