Recombinant Shigella boydii serotype 4 Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; SBO_1537; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links

KEGG: sbo:SBO_1537

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and how does it function in Shigella boydii?

MdtI is a component of the MdtJI protein complex that functions as a spermidine exporter in bacteria. This 109-amino acid protein belongs to the small multidrug resistance (SMR) family of drug exporters. In Shigella boydii serotype 4, the MdtI protein works cooperatively with MdtJ to form a functional complex that catalyzes the excretion of spermidine from cells, particularly when spermidine levels become elevated .

Research has demonstrated that both MdtJ and MdtI are necessary for spermidine export activity - neither protein alone is sufficient. Experiments with E. coli strains deficient in spermidine acetyltransferase (which normally metabolizes spermidine) showed that expression of both mdtJ and mdtI genes was required to rescue cells from spermidine toxicity .

How does the MdtJI complex regulate polyamine levels in Shigella?

The MdtJI complex plays a crucial role in polyamine homeostasis in Shigella by facilitating the export of spermidine, particularly under conditions where intracellular spermidine accumulates to potentially toxic levels. The complex functions as follows:

  • The level of mdtJI mRNA increases in response to elevated spermidine concentrations, indicating transcriptional regulation.

  • The MdtJI complex catalyzes the excretion of spermidine from cells.

  • This export mechanism helps reduce intracellular spermidine content when cells are cultured in environments with high spermidine concentrations (e.g., 2 mM spermidine).

  • By exporting excess spermidine, the MdtJI complex helps maintain cellular viability and growth .

Interestingly, Shigella species have inactivated the speG gene (encoding spermidine acetyltransferase) through convergent evolution, resulting in increased intracellular spermidine levels. This appears to be a pathoadaptive mutation that enhances Shigella survival under oxidative stress conditions encountered inside macrophages .

What expression systems are recommended for producing recombinant MdtI protein?

For successful expression of recombinant Shigella boydii serotype 4 MdtI protein, E. coli-based expression systems have proven effective. The methodology includes:

  • Vector selection: Vectors with strong inducible promoters (like T7) and appropriate tags (such as His-tag) facilitate protein purification.

  • Host strain selection: E. coli strains optimized for membrane protein expression are recommended, as MdtI is a membrane protein.

  • Expression conditions:

    • Growth at lower temperatures (16-25°C) after induction

    • Use of moderate inducer concentrations

    • Extended expression times (overnight)

In published research, recombinant full-length Shigella boydii serotype 4 MdtI protein (Q320V5) with an N-terminal His-tag has been successfully expressed in E. coli .

What amino acid residues are critical for MdtI function?

Research has identified several key amino acid residues that are essential for the spermidine export activity of MdtI. Site-directed mutagenesis studies have revealed that the following residues in MdtI are particularly important:

  • Glu5

  • Glu19

  • Asp60

  • Trp68

  • Trp81

These residues are believed to be involved in substrate recognition, transport, or in maintaining the proper structural conformation of the protein. Mutations at these positions significantly impair the ability of the MdtJI complex to excrete spermidine .

For comprehensive structure-function studies, researchers should consider performing alanine-scanning mutagenesis across the entire MdtI sequence to identify additional functionally important residues.

How should I design experiments to assess MdtI-mediated spermidine export activity?

To effectively measure MdtI-mediated spermidine export activity, consider the following experimental approach:

Cell viability assay:

  • Use a bacterial strain deficient in spermidine acetyltransferase (e.g., E. coli CAG2242)

  • Transform cells with plasmids expressing MdtI alone, MdtJ alone, or both MdtJ and MdtI

  • Culture cells in the presence of varying concentrations of spermidine (2-12 mM)

  • Measure cell viability using standard methods (e.g., colony counting)

  • Compare viability between transformed and untransformed cells

Direct measurement of spermidine export:

  • Load cells with [14C]spermidine

  • Monitor the excretion of [14C]spermidine over time

  • Confirm spermidine in the extracellular medium by polyamine analysis

Measurement of intracellular spermidine content:

  • Culture cells with and without plasmids expressing MdtJI

  • Extract polyamines from cells

  • Quantify spermidine content using HPLC or other analytical methods

Controls should include cells transformed with empty vectors and cells expressing other membrane transporters .

What experimental design approaches are most effective for studying MdtI function?

For robust investigation of MdtI function, consider implementing these experimental design approaches:

When designing experiments, ensure inclusion of appropriate controls, randomization, and replication to enhance reliability of results. Statistical power analysis should be performed prior to experimentation to determine adequate sample sizes .

How does MdtI in Shigella boydii compare to homologs in other Shigella species and E. coli?

MdtI is highly conserved across Shigella species and E. coli, reflecting their close evolutionary relationship. Comparative analysis reveals:

  • Sequence similarity: MdtI proteins show high sequence identity (>95%) between Shigella boydii and E. coli, with most variations occurring in non-critical regions.

  • Functional conservation: Both Shigella and E. coli MdtJI complexes function as spermidine exporters, requiring both components for activity.

  • Regulatory differences: While the protein sequence is conserved, there are notable differences in the regulation of mdtJI expression between species:

    • In Shigella, multifactor regulation involves VirF and H-NS (histone-like nucleoid structuring protein)

    • Studies show differential mdtJI expression levels in Shigella compared to E. coli under various conditions

  • Pathoadaptation context: In Shigella species, MdtI function should be viewed in the context of other polyamine metabolism adaptations, particularly the inactivation of speG (spermidine acetyltransferase) which has occurred through convergent evolution in all Shigella species .

Quantitative PCR studies have shown variable mdtJI transcription levels across different Shigella strains, with factors such as temperature, growth phase, and the presence of regulatory proteins affecting expression .

What is the relationship between MdtI function and Shigella pathogenesis?

The relationship between MdtI function and Shigella pathogenesis involves several interconnected aspects:

  • Polyamine homeostasis: MdtI contributes to polyamine homeostasis through spermidine export. This is particularly significant given that Shigella has inactivated speG, resulting in higher intracellular spermidine levels.

  • Oxidative stress resistance: Higher spermidine levels enhance survival under oxidative stress, which Shigella encounters inside macrophages. The MdtJI complex may help regulate optimal spermidine concentrations for this protective effect.

  • Virulence regulation: Real-time PCR analysis has shown that mdtJI expression in Shigella is influenced by VirF, a key virulence regulator, suggesting integration of polyamine export with virulence mechanisms.

  • Intracellular survival: By participating in polyamine regulation, MdtI may contribute to Shigella's ability to survive inside host cells. Experiments in mouse peritoneal macrophages have shown that polyamine metabolism affects bacterial survival .

The complex interplay between MdtI function, polyamine metabolism, and virulence makes this protein relevant to understanding Shigella pathogenesis mechanisms, particularly in the context of the bacteria's evolution from commensal E. coli to an intracellular pathogen.

What structural characteristics of MdtI are important for designing interaction studies?

MdtI is a small integral membrane protein with several key structural characteristics that should be considered when designing interaction studies:

  • Transmembrane topology: MdtI contains multiple transmembrane domains that span the bacterial membrane. This topology is critical for its function in spermidine export.

  • Key functional residues: Several charged and aromatic residues are essential for MdtI function:

    • Negatively charged residues: Glu5, Glu19, Asp60

    • Aromatic residues: Trp68, Trp81
      These residues are likely involved in substrate binding or transport mechanisms .

  • Hetero-oligomerization interface: MdtI forms a functional complex with MdtJ. The interface between these proteins is critical for spermidine export activity.

  • Small size: At 109 amino acids, MdtI is relatively small, which presents both challenges and opportunities for structural studies.

For protein-protein interaction studies, consider using techniques such as bacterial two-hybrid systems, co-immunoprecipitation with tagged versions of the proteins, or FRET-based approaches if fluorescent protein fusions remain functional.

How can I design experiments to study the MdtI-MdtJ interaction?

To effectively study the MdtI-MdtJ interaction, consider implementing these methodological approaches:

  • Co-expression and co-purification:

    • Express both proteins with different affinity tags (e.g., His-tag on MdtI, GST-tag on MdtJ)

    • Perform tandem affinity purification to isolate the complex

    • Analyze the stoichiometry of the purified complex

  • Crosslinking studies:

    • Use chemical crosslinkers with different spacer lengths

    • Identify crosslinked peptides by mass spectrometry to map interaction interfaces

  • FRET-based interaction analysis:

    • Create fusion proteins with fluorescent protein pairs

    • Measure FRET efficiency in living cells

    • Use acceptor photobleaching or lifetime measurements for quantitative analysis

  • Split-reporter systems:

    • Fuse complementary fragments of a reporter protein (e.g., GFP, luciferase) to MdtI and MdtJ

    • Monitor reconstitution of reporter activity as indicator of interaction

  • Bacterial two-hybrid assays:

    • Fuse proteins to complementary fragments of a transcription factor

    • Measure reporter gene expression as indicator of interaction

Control experiments should include known non-interacting membrane proteins and versions of MdtI or MdtJ with mutations that disrupt interaction but maintain proper membrane localization .

How does MdtI contribute to antimicrobial resistance in Shigella boydii?

While MdtI primarily functions as a spermidine exporter, its potential contributions to antimicrobial resistance in Shigella boydii are multifaceted:

Research on S. flexneri has shown that multidrug-resistant strains often display altered expression of various transporter systems, potentially including MdtI, which collectively contribute to the MDR phenotype .

What is known about the genetic context of mdtI in multidrug-resistant Shigella strains?

The genetic context of mdtI in multidrug-resistant Shigella strains reveals important insights about its potential role in antimicrobial resistance:

  • Chromosomal location: The mdtI gene is typically located in the bacterial chromosome rather than on resistance plasmids. In Shigella boydii serotype 4, it is designated as gene SBO_1537 .

  • Genetic organization: The mdtI gene is co-transcribed with mdtJ as an operon, with expression regulated by multiple factors:

    • VirF (virulence regulator) appears to influence mdtJI expression

    • H-NS (histone-like nucleoid structuring protein) may repress mdtJI

    • Spermidine levels affect mdtJI mRNA levels

  • Relationship with MDR plasmids: While mdtI itself is not typically carried on resistance plasmids, multidrug-resistant Shigella strains often harbor multiple plasmids carrying various resistance genes. For example:

    • pKSR100-related plasmids carry macrolide resistance genes

    • Some Shigella strains can carry up to 12 distinct plasmids

  • Genomic plasticity: Shigella species show evidence of significant genomic rearrangements and gene acquisitions during evolution. Analysis of O-antigen gene clusters in S. boydii reveals atypical genetic organization, suggesting genomic plasticity that may extend to other regions including transporter genes .

Recent genomic analyses of 1,246 Shigella isolates from low and middle-income countries revealed substantial genetic diversity and evidence of regional differences in antimicrobial resistance determinants, providing context for understanding the role of genes like mdtI .

Why might recombinant MdtI protein show poor solubility and how can this be addressed?

Recombinant MdtI protein often shows poor solubility due to its nature as an integral membrane protein with multiple transmembrane domains. To address solubility issues:

  • Optimization of expression conditions:

    • Reduce expression temperature (16-20°C)

    • Use lower inducer concentrations

    • Consider auto-induction media

    • Express protein in specialized E. coli strains (e.g., C41(DE3), C43(DE3))

  • Fusion partners to improve solubility:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

    • NusA

  • Detergent screening:

    • Test a panel of detergents (DDM, LDAO, FC-12, etc.)

    • Use fluorescence-based thermal stability assays to identify optimal detergents

    • Consider newer amphipathic polymers like SMALPs

  • Buffer optimization:

    • Screen various pH conditions (typically 7.0-8.0)

    • Test different salt concentrations

    • Include glycerol (5-10%)

    • Add stabilizing agents like arginine or trehalose

  • Extraction methods:

    • Use mild extraction conditions

    • Consider stepwise solubilization

    • Optimize detergent:protein ratio

According to product information, recombinant full-length Shigella boydii serotype 4 MdtI has been successfully produced with a His-tag and is available in lyophilized form, suggesting that with proper methods, solubility challenges can be overcome .

What factors might affect the reproducibility of MdtI functional assays?

Reproducibility challenges in MdtI functional assays often stem from several factors:

  • Protein quality issues:

    • Incomplete solubilization

    • Heterogeneous oligomeric state

    • Partial denaturation during purification

    • Batch-to-batch variation in expression

  • Assay-specific variables:

    • For spermidine export assays: variability in [14C]spermidine loading efficiency

    • For viability assays: growth phase differences of starter cultures

    • For polyamine content analysis: extraction efficiency variations

  • Environmental conditions:

    • Temperature fluctuations during assays

    • Variations in media composition

    • Oxygen levels affecting bacterial metabolism

  • Experimental design considerations:

    • Inadequate controls

    • Suboptimal sampling frequency

    • Insufficient replication

To enhance reproducibility, implement rigorous experimental design principles:

  • Use factorial or fractional factorial designs to identify critical variables

  • Include both positive and negative controls in each experiment

  • Implement randomization and blinding where possible

  • Use statistical power analysis to determine appropriate sample sizes

  • Document all experimental conditions meticulously

When evaluating MdtI function in spermidine export, the gold standard approach combines multiple methods: cell viability assays under spermidine stress, direct measurement of spermidine export, and quantification of intracellular polyamine content .

What are the unresolved questions about MdtI's role in Shigella pathogenesis?

Several critical questions about MdtI's role in Shigella pathogenesis remain unresolved:

  • Regulation during infection:

    • How is mdtI expression regulated during different stages of infection?

    • Do host factors influence mdtI expression?

    • Is there tissue-specific regulation of mdtI in different host environments?

  • Contribution to virulence:

    • What is the quantitative contribution of MdtI-mediated spermidine export to Shigella survival inside macrophages?

    • How does MdtI function integrate with other virulence mechanisms?

    • Does MdtI influence expression of virulence genes through polyamine-mediated effects?

  • Structural biology questions:

    • What is the precise stoichiometry of the MdtJI complex?

    • How does substrate recognition and transport occur at the molecular level?

    • Are there host-specific adaptations in the MdtI protein of Shigella compared to commensal E. coli?

  • Evolutionary aspects:

    • How has MdtI co-evolved with the inactivation of speG in Shigella species?

    • Are there strain-specific variations in MdtI function across different Shigella isolates?

    • What selective pressures have shaped MdtI evolution in Shigella?

Future research should investigate these questions using combinations of structural biology, genetic manipulation, infection models, and comparative genomics approaches .

How might MdtI be exploited as a target for antimicrobial development?

The potential of MdtI as a target for antimicrobial development presents several intriguing avenues:

  • Direct inhibition strategies:

    • Small molecule inhibitors that block spermidine transport

    • Peptidomimetic compounds targeting the MdtI-MdtJ interface

    • Allosteric inhibitors that lock the transporter in inactive conformations

  • Polyamine metabolism targeting:

    • Combination approaches targeting both MdtI and polyamine biosynthesis

    • Compounds that disrupt the balance between polyamine export and import

    • Polyamine analogs that compete with spermidine but cause toxicity when retained

  • Exploiting species-specific differences:

    • Target regions of MdtI that differ between pathogenic Shigella and commensal bacteria

    • Develop compounds that specifically interact with Shigella-specific residues

    • Exploit differences in regulation between Shigella and non-pathogenic E. coli

  • Novel screening approaches:

    • Design cell-based assays using reporter systems linked to polyamine stress

    • Implement fragment-based drug discovery focused on MdtI

    • Use computational approaches to identify potential binding pockets

  • Resistance considerations:

    • Investigate potential resistance mechanisms against MdtI inhibitors

    • Develop dual-targeting compounds to minimize resistance development

    • Model evolutionary pathways that might lead to resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.