Recombinant Shigella boydii serotype 4 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtJ; SBO_1536; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links

KEGG: sbo:SBO_1536

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii and how does it relate to other Shigella species?

Shigella boydii is one of the four species within the Shigella genus, which comprises Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacteria first discovered in 1897 . While Shigella flexneri is the most prevalent species globally (accounting for approximately 60% of isolates), S. boydii represents a significant proportion of infections in specific geographic regions . Shigella species cause disease exclusively in primates, including humans and gorillas, but not in other mammals .

The genus is closely related to Escherichia coli and constitutes one of the leading bacterial causes of diarrhea worldwide, with particular impact on children in African and South Asian countries . The taxonomic relationship between Shigella species is determined through biochemical profiling, serological typing, and genomic analysis. Identification typically involves techniques such as API 20E biochemical testing, which examines abilities to ferment specific substrates including glucose, mannitol, melibiose, and arabinose .

What is the MdtJ protein and what is its primary function in bacterial physiology?

The MdtJ protein is a membrane transport protein that belongs to the small multidrug resistance (SMR) family of drug exporters . Its primary physiological function involves the export of spermidine, a polyamine compound that can become toxic when accumulated at high intracellular concentrations . MdtJ does not function independently but rather operates as part of a protein complex with MdtI to form the MdtJI spermidine excretion system .

The critical nature of this function has been demonstrated through experiments with E. coli strains deficient in spermidine acetyltransferase (an enzyme that metabolizes spermidine). In these strains, overaccumulation of spermidine leads to cell toxicity and growth inhibition, effects that can be reversed through the expression of functional MdtJI complexes . The system's importance is further highlighted by the observation that mdtJI mRNA levels increase in response to elevated spermidine concentrations, indicating a regulatory feedback mechanism that helps maintain polyamine homeostasis .

How is the mdtJ gene regulated in response to environmental conditions?

The regulation of mdtJ expression appears to be directly linked to spermidine concentrations in the cellular environment. Research has demonstrated that exposure to elevated spermidine levels induces an increase in mdtJI mRNA expression . This regulatory response enables bacteria to adaptively manage polyamine homeostasis under varying environmental conditions.

The mechanistic details of this regulation likely involve transcriptional control mechanisms that sense intracellular spermidine concentrations and modulate gene expression accordingly. While the specific transcription factors and binding sites involved in mdtJ regulation are not fully characterized in the provided search results, the evidence for spermidine-induced upregulation suggests the presence of a dedicated sensory and regulatory pathway.

Experimental approaches to study this regulation typically include:

  • RT-qPCR analysis of mdtJ mRNA levels under varying spermidine concentrations

  • Reporter gene assays using the mdtJ promoter region

  • Chromatin immunoprecipitation to identify transcription factor binding sites

  • Deletion analysis of the promoter region to identify regulatory elements

What is the structural basis for MdtJ function, and which amino acid residues are critical for activity?

The functional activity of MdtJ depends on specific conserved amino acid residues within its structure. Mutational studies have identified several key residues in both MdtJ and its partner protein MdtI that are essential for spermidine export activity .

For the MdtJ protein, the following residues are critical for function:

  • Tyrosine-4 (Tyr4)

  • Tryptophan-5 (Trp5)

  • Glutamic acid-15 (Glu15)

  • Tyrosine-45 (Tyr45)

  • Tyrosine-61 (Tyr61)

  • Glutamic acid-82 (Glu82)

These residues are likely involved in substrate recognition, binding, or the conformational changes necessary for the transport mechanism . The predominance of aromatic (Tyr, Trp) and acidic (Glu) residues suggests a mechanism involving π-cation interactions with the positively charged spermidine molecule and electrostatic interactions, respectively.

The table below summarizes the critical residues in both proteins of the MdtJI complex:

ProteinCritical Residues
MdtJTyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82
MdtIGlu5, Glu19, Asp60, Trp68, Trp81

Researchers studying structure-function relationships in MdtJ should employ site-directed mutagenesis of these residues, followed by functional assays measuring spermidine export activity. Complementary approaches include molecular dynamics simulations to predict the effects of mutations on protein structure and substrate interactions.

What experimental methods can be used to study the MdtJ protein function in vitro?

To comprehensively characterize MdtJ function in vitro, researchers should employ a multifaceted experimental approach:

  • Recombinant Protein Expression and Purification:

    • Expression in heterologous systems (E. coli, yeast, baculovirus, or mammalian cells)

    • Inclusion of appropriate affinity tags for purification

    • Membrane protein extraction using detergents or nanodiscs to maintain native conformation

  • Transport Activity Assays:

    • Measurement of spermidine export in cells cultured with defined spermidine concentrations (e.g., 2 mM)

    • Radiolabeled spermidine uptake/efflux studies in proteoliposomes

    • Fluorescence-based assays using labeled spermidine analogs

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation of MdtJ and MdtI

    • FRET or BiFC assays to confirm complex formation in live cells

    • Crosslinking studies followed by mass spectrometry analysis

  • Structural Analysis:

    • X-ray crystallography or cryo-EM of the MdtJI complex

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • NMR studies of labeled proteins to assess dynamics

  • Mutagenesis Studies:

    • Site-directed mutagenesis of key residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82)

    • Creation of chimeric proteins to identify domain functions

    • Alanine-scanning mutagenesis to identify additional functional residues

When studying MdtJ function, it is critical to recognize that both MdtJ and MdtI proteins are necessary for spermidine export activity, as demonstrated by complementation experiments in spermidine acetyltransferase-deficient E. coli strains .

How can recombinant techniques be optimized for expression of functional MdtJ protein?

Optimizing recombinant expression of membrane proteins like MdtJ requires careful consideration of host systems, expression conditions, and purification strategies:

  • Selection of Expression System:
    Multiple expression systems should be evaluated, including E. coli, yeast, baculovirus, and mammalian cell lines . Each system offers different advantages:

    • E. coli: High yield, economical, but may encounter issues with membrane protein folding

    • Yeast: Better for eukaryotic-like post-translational modifications

    • Baculovirus: Superior for complex membrane proteins requiring chaperones

    • Mammalian cells: Best for maintaining native conformation but lower yield

  • Expression Vector Design:

    • Incorporate inducible promoters to control expression timing and level

    • Include fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Design constructs with varying N- and C-terminal regions to identify optimal protein boundaries

    • Consider codon optimization for the expression host

  • Culture Conditions Optimization:

    • Test various induction temperatures (typically lower temperatures of 16-25°C improve folding)

    • Optimize inducer concentration and induction timing

    • Evaluate different media compositions, including defined minimal media

    • Consider additives like glycerol or specific lipids to stabilize membrane proteins

  • Protein Extraction and Purification:

    • Screen multiple detergents for efficient solubilization (DDM, LMNG, CHAPS)

    • Implement affinity chromatography followed by size exclusion chromatography

    • Consider on-column refolding if inclusion bodies form

    • Evaluate nanodiscs or amphipols for maintaining native conformation

  • Functional Validation:

    • Verify proper folding through circular dichroism spectroscopy

    • Confirm complex formation with MdtI through co-purification

    • Validate function through in vitro transport assays

    • Assess thermal stability using differential scanning fluorimetry

For researchers working specifically with the Shigella boydii MdtJ protein, it is advisable to co-express both MdtJ and MdtI simultaneously, as the functional unit appears to be the heteromeric complex rather than individual proteins .

How does MdtJ contribute to antimicrobial resistance mechanisms in Shigella species?

While MdtJ primarily functions as a spermidine exporter, its membership in the small multidrug resistance (SMR) family suggests potential roles in broader antimicrobial resistance mechanisms . The contribution of MdtJ to drug resistance should be examined in the context of the increasingly concerning multidrug resistance patterns observed in Shigella species.

Newly emerging Shigella serotypes have demonstrated alarming resistance profiles. For example, the novel S. flexneri serotype 4s showed complete resistance to multiple antibiotics including tetracycline, ampicillin, amoxicillin, ampicillin-sulbactam, chloramphenicol, trimethoprim-sulfa, nalidixic acid, norfloxacin, and ciprofloxacin, with intermediate resistance to levofloxacin . While this specific example pertains to S. flexneri rather than S. boydii, it illustrates the severe multidrug resistance evolving within the Shigella genus.

The potential mechanisms through which MdtJ might contribute to antimicrobial resistance include:

  • Direct Drug Efflux:

    • As a member of the SMR family, MdtJ may directly participate in the export of certain antibiotics

    • The MdtJI complex could have broader substrate specificity than currently recognized

  • Physiological Adaptation:

    • Spermidine homeostasis may influence bacterial stress responses and adaptability

    • Polyamine export could modulate membrane permeability to antibiotics

  • Biofilm Formation:

    • Polyamines influence biofilm development, which can enhance antibiotic tolerance

    • MdtJ-mediated polyamine export may regulate biofilm physiology

Research methodologies to investigate these connections should include:

  • Generation of mdtJ knockout mutants and assessment of antibiotic susceptibility profiles

  • Transcriptomic analysis comparing wild-type and mdtJ-deficient strains under antibiotic stress

  • Transport assays with radiolabeled antibiotics to directly assess MdtJ-mediated export

  • Structural modeling to predict potential antibiotic binding sites in the MdtJ protein

What bioinformatic approaches can identify conserved domains and potential inhibitors of the MdtJ protein?

Comprehensive bioinformatic analysis of MdtJ can reveal evolutionary conservation, structural insights, and potential inhibitor candidates through the following methodologies:

  • Sequence Conservation Analysis:

    • Multiple sequence alignment of MdtJ homologs across bacterial species

    • Calculation of conservation scores to identify functionally constrained regions

    • Phylogenetic analysis to understand evolutionary relationships

    • Identification of co-evolving residues that may interact functionally

  • Structural Prediction and Analysis:

    • Ab initio or homology-based 3D structure prediction

    • Molecular dynamics simulations to assess conformational dynamics

    • Identification of potential substrate binding pockets

    • Analysis of electrostatic surface properties relevant to spermidine binding

  • Virtual Screening for Inhibitor Discovery:

    • Structure-based virtual screening against compound libraries

    • Pharmacophore modeling based on known SMR inhibitors

    • Molecular docking studies focused on the critical residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82)

    • Fragment-based drug design approaches

  • Systems Biology Integration:

    • Network analysis to identify functional relationships with other proteins

    • Prediction of effects of MdtJ inhibition on cellular pathways

    • Integration with transcriptomic data to understand regulatory networks

    • Identification of synthetic lethal interactions for combination therapy strategies

The table below outlines key bioinformatic tools applicable to MdtJ analysis:

Analysis TypeRecommended ToolsApplication to MdtJ
Sequence AnalysisBLAST, MUSCLE, HMMerIdentify homologs, conserved domains
Structure PredictionAlphaFold2, SWISS-MODELGenerate 3D structural models
Molecular DockingAutoDock Vina, HADDOCKScreen potential inhibitors
MD SimulationsGROMACS, NAMDAssess conformational dynamics
Network AnalysisCytoscape, STRINGMap functional interactions

Researchers should prioritize analysis of the conserved residues identified as critical for function (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82) , as these represent the most promising targets for structure-based inhibitor design.

How can researchers effectively develop assays to measure MdtJ-mediated spermidine export activity?

Developing robust assays for MdtJ-mediated spermidine export requires careful consideration of experimental design, controls, and quantification methods:

  • Cellular Assay Systems:

    • Use of spermidine acetyltransferase-deficient strains to prevent metabolic confounding

    • Complementation with plasmids encoding wild-type or mutant mdtJ/mdtI

    • Development of inducible expression systems to control protein levels

    • Creation of reporter strains with spermidine-responsive promoters

  • Quantification Methodologies:

    • Direct measurement of intracellular and extracellular spermidine concentrations

    • Application of HPLC, LC-MS/MS, or capillary electrophoresis for polyamine quantification

    • Use of radiolabeled or fluorescently labeled spermidine analogs

    • Real-time monitoring using fluorescence-based biosensors

  • Experimental Controls:

    • Empty vector controls to account for plasmid effects

    • Single gene expression (mdtJ or mdtI alone) to confirm complex requirement

    • Point mutations in critical residues as negative controls

    • Competitive inhibitors to confirm specificity

  • Data Analysis Approaches:

    • Time-course experiments to determine export kinetics

    • Dose-response studies with varying spermidine concentrations

    • Calculation of transport efficiency (Vmax, Km) for wild-type vs. mutant proteins

    • Statistical methods to assess significance of observed differences

In the published literature, researchers have successfully demonstrated MdtJI-mediated spermidine export by measuring spermidine content in cells cultured in the presence of 2 mM spermidine, showing decreased intracellular levels and enhanced extracellular spermidine in cells expressing functional MdtJI . This approach can serve as a foundation for developing more sophisticated assays.

What are the challenges in crystallizing the MdtJ-MdtI complex for structural studies?

Crystallization of membrane protein complexes like MdtJ-MdtI presents several significant challenges that researchers must address through specialized techniques:

  • Inherent Challenges of Membrane Protein Crystallization:

    • Hydrophobic nature requiring detergents or lipid environments

    • Conformational heterogeneity affecting crystal packing

    • Limited polar surfaces for crystal contact formation

    • Instability when removed from the membrane environment

  • Complex-Specific Considerations:

    • Maintaining the native stoichiometry of the MdtJ-MdtI complex

    • Preserving physiologically relevant interactions between subunits

    • Capturing functionally relevant conformational states

    • Preventing aggregation during concentration steps

  • Technical Approaches to Overcome Challenges:

    • Screening diverse detergents and lipidic cubic phase methods

    • Use of antibody fragments or nanobodies to stabilize specific conformations

    • Application of fusion proteins to increase polar surface area

    • Incorporation of thermostabilizing mutations

  • Alternative Structural Approaches:

    • Cryo-electron microscopy for structure determination without crystals

    • Solid-state NMR techniques for membrane proteins

    • Small-angle X-ray scattering for low-resolution envelope determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamic information

Researchers working on MdtJ-MdtI structural studies should consider implementing a hybrid approach, combining multiple structural techniques to overcome the limitations of each individual method. Preliminary biochemical characterization to identify stable detergent conditions and optimal protein constructs is essential before attempting crystallization trials.

How should researchers analyze contradictory findings related to MdtJ function across different bacterial species?

When encountering contradictory findings regarding MdtJ function across different bacterial species, researchers should implement a systematic analysis framework:

  • Comparative Analysis Methodology:

    • Perform sequence alignment of mdtJ genes and proteins across species

    • Identify conservation patterns in key functional residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82)

    • Examine genetic context and operon structure in different species

    • Consider phylogenetic relationships in relation to functional divergence

  • Experimental Validation Approaches:

    • Cross-species complementation experiments

    • Chimeric protein construction to identify species-specific functional domains

    • Standardized assay conditions to eliminate methodological variables

    • Side-by-side testing of proteins from different species

  • Contextual Factors to Consider:

    • Differences in physiological polyamine requirements between species

    • Variations in membrane composition affecting protein function

    • Alternative polyamine transport systems that may compensate for MdtJ

    • Species-specific regulatory mechanisms controlling mdtJ expression

  • Resolving Contradictions:

    • Develop testable hypotheses to explain observed differences

    • Design critical experiments that can distinguish between alternative explanations

    • Consider the possibility of convergent evolution leading to similar proteins with distinct functions

    • Evaluate methodological differences that might explain contradictory results

Researchers should be particularly attentive to differences between findings in E. coli (where much of the MdtJ functional characterization has been conducted) and Shigella species, which are closely related but may have evolved distinct functional adaptations.

What statistical approaches are appropriate for analyzing MdtJ expression and activity data?

  • Experimental Design Considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures to minimize bias

    • Inclusion of appropriate positive and negative controls

    • Technical and biological replication strategy

  • Statistical Methods for Expression Data:

    • Normalization approaches for RT-qPCR data (reference genes, efficiency correction)

    • ANOVA with post-hoc tests for multi-condition comparisons

    • Linear mixed effects models to account for batch effects

    • Multiple testing correction (Benjamini-Hochberg, Bonferroni) for genome-wide studies

  • Analysis of Transport Activity:

    • Michaelis-Menten kinetics modeling for transport assays

    • Regression analysis for dose-response relationships

    • Paired statistical tests for before/after comparisons

    • Non-parametric methods for data not meeting normality assumptions

  • Advanced Statistical Approaches:

    • Bayesian inference to incorporate prior knowledge

    • Principal component analysis for multivariate datasets

    • Clustering methods to identify patterns in expression data

    • Time series analysis for kinetic experiments

The table below summarizes appropriate statistical tests for common MdtJ research questions:

Research QuestionExperimental ApproachAppropriate Statistical Test
Does spermidine induce mdtJ expression?RT-qPCR with/without spermidinePaired t-test or Wilcoxon signed-rank test
How do multiple mutations affect MdtJ function?Transport assays with various mutantsOne-way ANOVA with Dunnett's post-hoc test
Is there correlation between expression and activity?Combined expression and functional assaysPearson or Spearman correlation analysis
How does MdtJ expression change over time?Time-course expression analysisRepeated measures ANOVA or mixed effects model

When analyzing data from transport assays, researchers should report not only p-values but also effect sizes and confidence intervals to provide a complete understanding of the biological significance of their findings.

What are the most promising approaches for developing inhibitors of MdtJ function?

The development of selective MdtJ inhibitors represents a promising research direction with potential applications in antimicrobial development:

  • Structure-Based Drug Design:

    • Virtual screening focused on binding sites containing critical residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82)

    • Fragment-based approaches to develop high-affinity ligands

    • Molecular dynamics simulations to identify transient binding pockets

    • Rational design of polyamine analogs that bind but are not transported

  • High-Throughput Screening Approaches:

    • Development of whole-cell assays measuring spermidine export

    • Fluorescence-based transport assays adaptable to automated platforms

    • Bacterial growth assays in spermidine-rich environments

    • Compound library screening with structurally diverse molecules

  • Peptide-Based Inhibitor Development:

    • Design of peptides mimicking MdtI interaction surfaces

    • Identification of peptide sequences that disrupt MdtJ-MdtI complex formation

    • Development of cell-penetrating peptides targeting intracellular domains

    • Cyclic peptide libraries for enhanced stability and membrane permeability

  • Alternative Inhibition Strategies:

    • Antisense oligonucleotides targeting mdtJ mRNA

    • CRISPR interference approaches to repress transcription

    • Allosteric inhibitors affecting conformational changes

    • Compounds that alter membrane properties around the MdtJ-MdtI complex

Challenges in this research direction include achieving selectivity against human polyamine transporters, ensuring adequate penetration of the bacterial membrane, and developing compounds with suitable pharmacokinetic properties. Researchers should consider combination approaches targeting both MdtJ function and other aspects of bacterial polyamine metabolism.

How might systems biology approaches enhance our understanding of MdtJ in the context of bacterial physiology?

Systems biology offers powerful frameworks for understanding MdtJ's role within broader bacterial physiological networks:

  • Multi-Omics Integration:

    • Combined analysis of transcriptomics, proteomics, and metabolomics data

    • Comparison of wild-type and mdtJ knockout strains under various conditions

    • Flux analysis of polyamine metabolism pathways

    • Network reconstruction incorporating MdtJ-related processes

  • Mathematical Modeling Approaches:

    • Kinetic modeling of polyamine transport and metabolism

    • Genome-scale metabolic models incorporating MdtJ function

    • Agent-based modeling of bacterial population responses to polyamine stress

    • Sensitivity analysis to identify critical control points in the system

  • Experimental Systems Biology:

    • Synthetic biology approaches to reconstruct minimal polyamine transport systems

    • High-throughput phenotyping of genetic interaction networks

    • Single-cell analysis of MdtJ expression and activity heterogeneity

    • Microfluidic systems to study dynamic responses to changing environments

  • Ecological and Evolutionary Perspectives:

    • Comparative genomics across bacterial species to trace MdtJ evolution

    • Analysis of selective pressures on polyamine transport systems

    • Investigation of MdtJ role in host-pathogen interactions

    • Examination of horizontal gene transfer patterns for mdtJ and related genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.