Recombinant Shigella boydii serotype 4 Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
dsbD; SBO_4319; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADEQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAASQPVSVSQQEQHTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDVWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNHALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANITANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function
This protein is essential for facilitating the formation of correct disulfide bonds in certain periplasmic proteins and for the assembly of periplasmic c-type cytochromes. It acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps.
Database Links

KEGG: sbo:SBO_4319

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella boydii and how prevalent is serotype 4?

Shigella boydii is one of four species in the Shigella genus, which was first discovered in 1897. It is a Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacterium that causes disease in primates such as humans and gorillas, but not in other mammals . Shigella is closely related to E. coli and represents one of the leading bacterial causes of diarrhea worldwide, particularly causing moderate-to-severe diarrhea in African and South Asian children .

According to prevalence studies conducted in Bangladesh, S. boydii type 4 is the third most common serotype among the 20 serotypes of S. boydii, accounting for approximately 9.2% of all S. boydii isolates . This places it behind serotype 12 (27.6%) and serotype 1 (11.7%) in prevalence . The relatively high prevalence of serotype 4 makes it an important target for research, particularly in developing diagnostic tools and potential therapeutic interventions.

Epidemiological studies have shown that while S. flexneri remains the most frequently isolated Shigella species worldwide (accounting for approximately 60% of cases), S. boydii represents a significant disease burden in specific geographical regions . The Global Enteric Multicenter Study (GEMS) identified that S. boydii accounts for approximately 5.4% of all Shigella isolates over a three-year period .

What is the thiol:disulfide interchange protein DsbD and what role does it play in bacteria?

The thiol:disulfide interchange protein DsbD (dsbD) is a transmembrane protein that plays a crucial role in the bacterial disulfide bond formation system. Based on the amino acid sequence information from related proteins such as S. dysenteriae DsbD, it contains multiple functional domains that facilitate electron transfer across the bacterial membrane . The protein typically consists of an N-terminal periplasmic domain, a central transmembrane domain, and a C-terminal periplasmic domain.

The primary function of DsbD is to maintain a reducing environment in the bacterial periplasm by transferring electrons from the cytoplasmic thioredoxin system to various periplasmic oxidoreductases. This function is essential for the proper folding of numerous bacterial proteins containing disulfide bonds, particularly those involved in virulence and bacterial survival under stress conditions.

In Shigella species, as in other enterobacteria, the DsbD protein forms part of a complex redox system that maintains the functionality of various periplasmic proteins. The full-length protein in S. dysenteriae serotype 1 spans amino acids 20-565, with a molecular structure that allows it to shuttle electrons from the cytoplasm to the periplasm . This mechanism is critical for bacterial adaptation to changing environmental conditions and for maintaining the function of proteins required for pathogenesis.

How is recombinant Shigella boydii serotype 4 DsbD protein typically expressed and purified?

The expression and purification of recombinant S. boydii serotype 4 DsbD protein typically follows similar methodologies to those used for other Shigella DsbD proteins. Based on established protocols for related proteins, the process generally involves the following steps:

  • Expression system selection: E. coli is the most commonly used host for expression, although yeast, baculovirus, or mammalian cell systems may also be employed depending on specific research requirements . For S. dysenteriae DsbD, E. coli expression systems with N-terminal His tags have been successfully utilized .

  • Vector construction: The dsbD gene sequence from S. boydii serotype 4 is typically cloned into an appropriate expression vector with a histidine tag for purification purposes. The gene can be expressed as the full-length mature protein (similar to amino acids 20-565 in S. dysenteriae) .

  • Culture conditions: Transformed E. coli cells are grown under optimized conditions, typically in LB broth at 37°C with appropriate antibiotic selection. Protein expression is usually induced using IPTG or similar inducers when the culture reaches the logarithmic growth phase.

  • Protein purification: After cell lysis, the His-tagged protein is commonly purified using nickel affinity chromatography, followed by additional purification steps such as ion exchange or size exclusion chromatography as needed for higher purity.

  • Storage formulation: The purified protein is typically stored in a Tris/PBS-based buffer, often with the addition of stabilizing agents such as trehalose (6%) at pH 8.0 . For long-term storage, addition of glycerol (25-50% final concentration) and storage at -20°C or -80°C is recommended .

It is crucial to avoid repeated freeze-thaw cycles during storage, as this can lead to protein denaturation and loss of activity. Aliquoting the purified protein and storing working aliquots at 4°C for up to one week is a common practice to maintain protein integrity .

What are the technical challenges in expressing and purifying functional S. boydii serotype 4 DsbD protein?

Expressing and purifying functional S. boydii serotype 4 DsbD protein presents several significant technical challenges:

  • Membrane protein solubility: As a transmembrane protein, DsbD contains hydrophobic regions that can lead to aggregation and inclusion body formation during expression. Researchers must optimize expression conditions (temperature, induction parameters) and sometimes employ specialized solubility tags to maintain protein solubility.

  • Maintaining redox state: The functional activity of DsbD depends on maintaining specific disulfide bonds and redox states. During purification, exposure to varying redox conditions can lead to improper disulfide bond formation or protein misfolding. Addition of reducing agents at specific stages may be necessary to preserve the native conformation.

  • Protein stability: The DsbD protein may exhibit limited stability once purified. Formulation with stabilizing agents such as trehalose (6%) and storage in appropriate buffer conditions (Tris/PBS-based buffer, pH 8.0) is crucial for maintaining protein integrity . For long-term storage, addition of glycerol (typically 25-50%) and storage at -80°C is recommended .

  • Functional assessment: Verifying that the purified recombinant protein retains its native electron transfer activity presents another challenge. Developing appropriate assays to measure the redox activity of purified DsbD requires careful consideration of substrate selection and reaction conditions.

  • Structural integrity: For structural studies (X-ray crystallography, cryo-EM), obtaining sufficient quantities of homogeneous, properly folded protein can be particularly challenging. The presence of both hydrophobic and hydrophilic domains may require specialized crystallization techniques or membrane mimetics.

Researchers have addressed these challenges through various strategies, including expression of individual domains rather than the full-length protein, use of specialized E. coli strains with enhanced disulfide bond formation capabilities, and employment of fusion partners that enhance solubility while minimizing interference with native function.

What are the optimal conditions for expression of recombinant S. boydii serotype 4 DsbD?

Optimizing the expression of recombinant S. boydii serotype 4 DsbD requires careful consideration of multiple parameters to maximize yield while maintaining protein functionality. Based on protocols established for similar proteins, the following conditions typically yield optimal results:

  • Expression system selection:

    • E. coli: The most commonly used host system due to its simplicity and high yield. Specialized strains such as BL21(DE3) pLysS or Origami (with enhanced disulfide bond formation) are often preferred .

    • Alternative systems: For specific applications requiring post-translational modifications, yeast, baculovirus, or mammalian cell systems may be considered .

  • Vector design considerations:

    • Promoter selection: T7 or tac promoters typically provide good control over expression levels.

    • Fusion tags: N-terminal His-tags facilitate purification while minimizing interference with protein folding . For problematic expressions, solubility enhancers like SUMO, MBP, or TrxA may be beneficial.

    • Codon optimization: Adapting the S. boydii dsbD gene sequence to the preferred codon usage of the expression host can significantly improve expression levels.

  • Culture conditions optimization:

ParameterOptimal RangeNotes
Temperature16-25°CLower temperature often improves proper folding
Induction pointOD600 0.6-0.8Mid-log phase typically yields best results
IPTG concentration0.1-0.5 mMLower concentrations favor proper folding
Post-induction time16-20 hoursExtended expression at lower temperatures
Media compositionLB or TBTB provides higher biomass for increased yield
AerationHigh (baffled flasks)Ensures proper oxygenation for high-density cultures
  • Cell lysis and initial processing:

    • For membrane-associated proteins like DsbD, gentle lysis methods using enzymatic approaches (lysozyme) combined with mild detergents often preserve protein structure better than mechanical disruption.

    • Buffer composition should include stabilizing agents and appropriate redox components to maintain the native conformation of the protein.

Systematic optimization of these parameters through design of experiments (DoE) approaches can significantly improve both yield and functionality of the recombinant protein. Expression trials at small scale followed by activity assays can guide the selection of optimal conditions before scaling up production.

What are the most effective methods for detecting and quantifying S. boydii serotype 4 in research samples?

Detection and quantification of S. boydii serotype 4 in research samples can be accomplished through several complementary approaches, each with specific advantages for particular research contexts:

  • Traditional Culture-Based Methods:

    • Selective media such as MacConkey agar allows for initial isolation of Gram-negative enteric bacteria .

    • Following isolation, slide agglutination tests using type- and group-specific monoclonal antibody reagents (such as those from Denka Seiken, Tokyo, Japan or Reagensia AB, Stockholm, Sweden) can specifically identify S. boydii serotype 4 .

    • These methods remain the gold standard for definitive identification but require 24-48 hours to complete.

  • Molecular Detection Methods:

    • PCR-based assays targeting serotype-specific genes provide rapid and specific detection.

    • Multiplex PCR approaches can simultaneously detect multiple Shigella species and serotypes, reducing the time and resources required for identification.

    • Real-time PCR offers quantitative assessment of bacterial load with detection limits as low as 10^2-10^3 CFU/ml in complex samples.

  • Bacteriophage-Based Detection:

    • Although the search results mention serotype-specific phages for S. boydii type 1, similar approaches could potentially be developed for serotype 4 .

    • Phage-based detection offers advantages in terms of specificity, simplicity, and potential for field application without sophisticated laboratory infrastructure.

    • The technique involves applying specific phages to bacterial cultures and observing for lytic plaques, which can be completed within 16-17 hours .

  • Immunological Methods:

    • ELISA using serotype-specific antibodies provides sensitive detection and quantification.

    • Immunofluorescence microscopy allows direct visualization of bacteria in complex samples.

    • Lateral flow immunoassays offer rapid point-of-care detection possibilities.

  • Mass Spectrometry Approaches:

    • MALDI-TOF MS can rapidly identify Shigella species and potentially discriminate between serotypes based on protein profiles.

    • This approach requires minimal sample preparation and can provide results within minutes.

For research requiring the highest specificity, a combination of molecular and serological approaches is typically recommended. The choice of method should be guided by the specific research question, required sensitivity, available resources, and time constraints. For epidemiological studies or work in resource-limited settings, phage-based or simplified molecular methods may offer the best balance of accuracy and practicality.

How can researchers effectively analyze the interaction between DsbD and other proteins in the disulfide bond formation pathway?

Analyzing interactions between DsbD and other proteins in the disulfide bond formation pathway requires a multi-faceted approach that combines biochemical, biophysical, and genetic techniques. The following methodologies are particularly effective for investigating these complex protein-protein interactions:

  • Co-immunoprecipitation (Co-IP) and Pull-down Assays:

    • Using antibodies against DsbD or fusion-tagged DsbD to isolate protein complexes from bacterial lysates.

    • This approach can identify stable interacting partners but may miss transient interactions.

    • Western blotting with antibodies against suspected partner proteins can confirm specific interactions.

  • Bacterial Two-Hybrid Systems:

    • Adapted for membrane proteins, these systems can detect direct interactions between DsbD and potential partners in vivo.

    • The BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is particularly suitable for membrane protein interactions.

    • Results can be quantified through reporter gene expression, providing semi-quantitative interaction strength measurements.

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinking followed by mass spectrometric analysis can capture both stable and transient interactions.

    • This technique also provides structural information about the interaction interfaces.

    • Data analysis requires sophisticated bioinformatics approaches to identify crosslinked peptides.

  • Surface Plasmon Resonance (SPR) and Biolayer Interferometry (BLI):

    • These techniques allow real-time monitoring of protein-protein interactions with label-free detection.

    • Kinetic parameters (kon, koff) and binding affinity (KD) can be determined.

    • Requires purified proteins and careful surface chemistry optimization for membrane proteins like DsbD.

  • Förster Resonance Energy Transfer (FRET):

    • By tagging DsbD and potential partners with appropriate fluorophores, interactions can be monitored in real-time in living cells.

    • This approach is particularly valuable for tracking dynamic interactions during the disulfide exchange process.

  • Genetic Approaches:

    • Synthetic lethal screens can identify functional interactions by looking for genes whose deletion is only lethal in combination with dsbD mutations.

    • Suppressor screens can identify compensatory mutations that restore function in dsbD mutants.

  • Computational Prediction and Modeling:

    • Molecular docking simulations can predict potential interaction interfaces.

    • Molecular dynamics simulations can provide insights into the dynamic nature of these interactions.

The combination of these complementary approaches provides a comprehensive understanding of how DsbD interacts with its partners in the disulfide bond formation pathway. Researchers should select methods based on their specific research questions, available resources, and the nature of the interactions being studied (stable vs. transient, direct vs. indirect).

How can recombinant S. boydii serotype 4 DsbD be used in vaccine development research?

Recombinant S. boydii serotype 4 DsbD protein offers several promising applications in vaccine development research, leveraging both its biological properties and the critical role of the Dsb system in bacterial pathogenesis:

It is important to note that all vaccine research applications using recombinant DsbD would require extensive preclinical testing. The search results specifically mention that recombinant vaccine ingredients "CANNOT be used directly on humans or animals" without appropriate testing and regulatory approval. Any vaccine development process would need to follow established regulatory pathways and safety assessment protocols.

What is the potential role of S. boydii serotype 4 DsbD as a target for antimicrobial development?

The thiol:disulfide interchange protein DsbD in S. boydii serotype 4 represents a promising target for antimicrobial development for several compelling reasons:

  • Essential Function in Bacterial Survival:

    • DsbD plays a critical role in maintaining the proper folding of numerous bacterial proteins through its redox functions. Inhibition of this activity could broadly impact bacterial viability and virulence.

    • Unlike many traditional antibiotic targets, the Dsb system affects multiple cellular processes simultaneously, potentially making resistance development more difficult.

  • Conservation and Specificity:

    • While DsbD proteins show conservation across Gram-negative bacteria, there are significant differences from mammalian disulfide bond formation systems. This divergence provides an opportunity for selective targeting of bacterial systems with minimal host toxicity.

    • The unique transmembrane arrangement and electron transfer mechanism of DsbD offer specific structural features that could be exploited for inhibitor design.

  • Potential Antimicrobial Strategies:

StrategyMechanismPotential Advantages
Small molecule inhibitorsDirect binding to active sites or allosteric sitesHigh specificity, potential for oral bioavailability
Peptide inhibitorsDisruption of protein-protein interactions within the Dsb systemHigh specificity, potential for reduced resistance
Phage-derived proteinsTargeted inactivation based on phage evolutionNovel mechanism of action, high specificity
Nanoparticle-based deliveryEnhanced delivery of inhibitors to bacterial periplasmImproved efficacy, reduced systemic exposure
  • Virulence Attenuation Approach:

    • Rather than directly killing bacteria, DsbD inhibitors could reduce pathogenicity by preventing proper folding of virulence factors. This approach might exert less selective pressure for resistance compared to conventional bactericidal antibiotics.

    • The WHO's designation of Shigella as a priority for new drug development highlights the need for such novel approaches .

  • Combination Therapy Potential:

    • Inhibitors of the Dsb system could potentially sensitize bacteria to existing antibiotics by compromising cell envelope integrity and stress response mechanisms.

    • This synergistic approach might allow for lower doses of conventional antibiotics, reducing side effects and potentially slowing resistance development.

Research in this direction would require detailed structural understanding of S. boydii serotype 4 DsbD, development of high-throughput screening assays for inhibitor identification, and ultimately, demonstration of efficacy in relevant infection models. The growing problem of antibiotic resistance makes such alternative approaches increasingly valuable for future therapeutic development.

How can structural studies of S. boydii serotype 4 DsbD contribute to understanding redox biology in enteric pathogens?

Structural studies of S. boydii serotype 4 DsbD can provide profound insights into redox biology in enteric pathogens, with implications extending beyond Shigella to other bacterial systems:

  • Electron Transfer Pathway Elucidation:

    • High-resolution structural determination of DsbD can reveal the precise arrangement of redox-active cysteine residues and their positioning within the protein's transmembrane and periplasmic domains.

    • This information is critical for understanding the step-by-step electron transfer mechanism from cytoplasmic thioredoxin through DsbD to various periplasmic substrate proteins.

    • Techniques such as X-ray crystallography or cryo-electron microscopy, potentially combined with site-directed spin labeling and electron paramagnetic resonance (EPR) spectroscopy, can capture different conformational states during the electron transfer process.

  • Comparative Structural Biology:

    • Comparing DsbD structures across different Shigella serotypes and other enteric pathogens can highlight conserved features essential for function versus variable regions that may contribute to serotype-specific properties.

    • Such comparisons would help identify structural adaptations that might correlate with differences in virulence or host specificity among different bacterial species.

  • Structure-Function Relationships:

    • Mapping amino acid sequence variations from S. dysenteriae DsbD (which has been more extensively characterized) onto structural models of S. boydii serotype 4 DsbD can predict functional differences.

    • The full-length S. dysenteriae DsbD protein (spanning amino acids 20-565) provides a valuable template for such comparative analyses.

  • Protein-Protein Interaction Interfaces:

    • Structural studies can identify the specific interfaces where DsbD interacts with its electron donors (typically cytoplasmic thioredoxin) and its various electron acceptors in the periplasm.

    • This information is valuable for understanding the specificity determinants governing these interactions and for potential therapeutic targeting.

  • Dynamic Aspects of Redox Protein Function:

    • Beyond static structures, techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into the dynamic conformational changes that accompany electron transfer.

    • Understanding these dynamics is essential for fully appreciating how redox proteins function in the bacterial cell envelope.

  • Evolutionary Insights:

    • Structural comparison of DsbD across diverse bacterial species can reveal evolutionary relationships and potential adaptations to different ecological niches.

    • This evolutionary perspective helps place the specific adaptations seen in S. boydii within a broader context of bacterial redox system evolution.

The knowledge gained from such structural studies extends beyond academic interest, informing the rational design of inhibitors targeting the bacterial disulfide bond formation pathway and potentially contributing to novel antimicrobial development strategies.

What are the key unresolved questions in S. boydii serotype 4 DsbD research?

Despite progress in understanding Shigella pathogenesis and the role of disulfide bond formation systems in bacterial virulence, several key questions regarding S. boydii serotype 4 DsbD remain unresolved:

  • Serotype-Specific Functions: How does the DsbD protein in S. boydii serotype 4 differ functionally from other serotypes and species of Shigella? Given that immunity to Shigella is serotype-specific , understanding the unique aspects of serotype 4 DsbD may reveal important pathogenesis mechanisms.

  • Substrate Specificity: What is the complete repertoire of periplasmic proteins that receive electrons from DsbD in S. boydii serotype 4, and how does this complement of substrates compare to other enteric pathogens? This question has significant implications for understanding serotype-specific virulence mechanisms.

  • Regulatory Networks: How is dsbD gene expression regulated in response to different environmental conditions encountered during infection? Understanding the regulatory networks controlling DsbD levels could reveal new approaches to modulate its activity.

  • Host-Pathogen Interactions: Does the host immune system specifically recognize DsbD or its substrate proteins during S. boydii infection? If so, how does this recognition contribute to pathogen clearance or persistence?

  • Therapeutic Targeting Potential: Can the DsbD protein be effectively targeted for antimicrobial development without triggering rapid resistance evolution? What structural features might be exploited for selective inhibition?

  • Environmental Adaptation: How does the DsbD system contribute to S. boydii serotype 4 survival in various environmental conditions, including water systems that serve as transmission vehicles? The prevalence study in Bangladesh demonstrated the importance of environmental factors in Shigella epidemiology .

  • Vaccine Development Prospects: Could DsbD or its substrate proteins serve as effective antigens for vaccine development against S. boydii? Given the serotype-specific nature of Shigella immunity , would such approaches provide cross-protection against multiple serotypes?

Addressing these questions requires interdisciplinary approaches combining molecular biology, structural biology, immunology, and epidemiology. The continued WHO prioritization of Shigella for research and development underscores the importance of resolving these knowledge gaps to develop better prevention and treatment strategies.

What emerging technologies might advance research on S. boydii serotype 4 DsbD in the near future?

Several emerging technologies show significant promise for advancing research on S. boydii serotype 4 DsbD in the coming years:

  • Cryo-Electron Microscopy (Cryo-EM) Advances:

    • Recent developments in cryo-EM technology now allow structural determination of membrane proteins at near-atomic resolution without the need for crystallization.

    • This could revolutionize our understanding of DsbD structure, particularly in capturing different conformational states during the electron transfer process.

    • The ability to visualize protein complexes in near-native environments could reveal how DsbD interacts with its various partner proteins in the bacterial membrane.

  • Single-Cell Technologies:

    • Single-cell RNA sequencing can reveal heterogeneity in dsbD expression among bacterial populations during infection.

    • This approach could identify subpopulations with distinct virulence potential based on differential expression of redox systems.

    • Combined with spatial transcriptomics, these methods could map dsbD expression patterns within infection sites.

  • CRISPR-Based Technologies:

    • CRISPR interference (CRISPRi) allows precise modulation of gene expression without permanent genetic modification.

    • This approach could enable fine-tuned studies of DsbD function by creating conditional knockdowns rather than complete knockouts.

    • CRISPR-based genome editing also facilitates rapid generation of mutant libraries for comprehensive functional studies.

  • Advanced Mass Spectrometry Techniques:

    • Developments in redox proteomics using mass spectrometry now allow comprehensive mapping of disulfide bonds and other redox modifications across the bacterial proteome.

    • These approaches could identify the complete set of proteins dependent on DsbD function in S. boydii serotype 4.

    • Quantitative proteomics can measure how DsbD disruption affects the global protein landscape in the bacterium.

  • Microfluidic Systems for Infection Models:

    • Organ-on-a-chip and other microfluidic systems can model host-pathogen interactions under controlled conditions.

    • These platforms could allow real-time visualization of redox processes during infection using appropriate biosensors.

    • Such systems bridge the gap between oversimplified in vitro models and complex in vivo systems.

  • Artificial Intelligence for Drug Discovery:

    • Machine learning approaches can accelerate the identification of potential DsbD inhibitors by screening virtual libraries and predicting binding properties.

    • Deep learning algorithms can identify patterns in protein-protein interfaces that might be targeted to disrupt DsbD function.

    • These computational approaches could significantly reduce the time and resources required for initial drug discovery phases.

  • Phage-Based Diagnostics and Therapeutics:

    • The successful development of phage-based diagnostics for S. boydii type 1 suggests similar approaches could be developed for serotype 4.

    • Engineered phages could potentially deliver specific inhibitors targeting DsbD or related systems directly to Shigella bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.