Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction to Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose Transferase (arnC)

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, encoded by the arnC gene, is an enzyme crucial for bacterial resistance to polymyxins and other cationic antimicrobial peptides. While the specific compound "Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)" is not directly referenced in the available literature, the arnC enzyme itself plays a significant role in modifying the lipid A component of bacterial lipopolysaccharides (LPS), enhancing resistance to these antimicrobials.

Function and Mechanism of ArnC

ArnC is a glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate, which is then attached to lipid A, a key component of the outer membrane of Gram-negative bacteria like Shigella and Escherichia coli . This modification is essential for resistance against polymyxins, which are used as last-resort antibiotics against multi-drug resistant bacteria.

Structure of ArnC

The structure of ArnC from Salmonella typhimurium has been resolved using cryo-electron microscopy, revealing a tetrameric arrangement with C2 symmetry. The enzyme consists of three main regions: an N-terminal glycosyltransferase domain, a transmembrane region, and interface helices that interact with adjacent protomers . The binding of UDP induces conformational changes that stabilize the enzyme's catalytic pocket.

Role in Bacterial Resistance

The arnC gene is part of the arnBCDTEF operon, which is involved in the modification of lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N), enhancing bacterial resistance to polymyxins . Deletion of arnC in polymyxin-resistant E. coli reduces the formation of the modified lipid A, underscoring its critical role in resistance mechanisms .

Research Findings and Implications

While specific research on "Recombinant Shigella boydii serotype 4 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)" is limited, studies on ArnC in other bacteria highlight its importance in antimicrobial resistance. Understanding the molecular mechanisms of ArnC can inform strategies to combat drug-resistant bacterial infections.

Data Table: Key Features of ArnC

FeatureDescription
FunctionTransfers 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate.
RoleEssential for bacterial resistance to polymyxins and cationic antimicrobial peptides.
StructureTetrameric arrangement with N-terminal glycosyltransferase domain, transmembrane region, and interface helices.
LocalizationInner membrane of Gram-negative bacteria.
OperonPart of the arnBCDTEF operon involved in lipid A modification.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SBO_2291; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-322
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
arnC
Target Protein Sequence
MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT DVRARPRYFVQQVIRPSSKENE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links

KEGG: sbo:SBO_2291

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of arnC in Shigella boydii serotype 4?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Shigella boydii serotype 4 plays a crucial role in lipid A modification pathways. This enzyme specifically catalyzes the transfer of the formylated sugar nucleotide UDP-β-(4-deoxy-4-formamido-L-arabinose) to undecaprenyl phosphate, creating an undecaprenyl phosphate-linked intermediate. This reaction represents an essential step in the biosynthetic pathway leading to the modification of lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N), which is critical for bacterial resistance to polymyxin and other cationic antimicrobial peptides. The enzyme is highly selective, as it can only process the formylated version of the sugar nucleotide, demonstrating the precise regulation of this resistance mechanism .

How does arnC contribute to antimicrobial resistance in gram-negative bacteria?

ArnC contributes to antimicrobial resistance by facilitating a critical step in the lipid A modification pathway that reduces the net negative charge of the bacterial outer membrane. By transferring the formylated L-Ara4N to undecaprenyl phosphate, arnC enables the subsequent incorporation of L-Ara4N onto the phosphate groups of lipid A. This modification neutralizes the negative charges on lipid A, thereby reducing the binding affinity of cationic antimicrobial peptides like polymyxins to the bacterial outer membrane. Without this modification pathway, bacteria remain susceptible to these antimicrobials.

The entire L-Ara4N modification pathway, including the arnC-catalyzed step, represents an adaptive response that is activated under specific environmental conditions, such as low Mg²⁺ concentrations or the presence of antimicrobial peptides. This modification is particularly important in clinical settings where polymyxins are used as last-resort antibiotics against multidrug-resistant gram-negative infections .

What is the relationship between Shigella boydii arnC and homologous enzymes in other bacterial species?

The arnC enzyme from Shigella boydii serotype 4 shares significant structural and functional homology with its counterparts in closely related Enterobacteriaceae, particularly Escherichia coli. This similarity is expected given that Shigella and E. coli are phylogenetically closely related, with Shigella often described as a pathotype of E. coli that has acquired virulence factors. The amino acid sequence identity between these homologs typically exceeds 90%, reflecting their conserved catalytic mechanism and substrate specificity .

What are the optimal conditions for expressing recombinant Shigella boydii arnC in E. coli expression systems?

Successful expression of recombinant Shigella boydii arnC in E. coli requires careful optimization of multiple parameters. The most effective expression system typically employs BL21(DE3) or its derivatives as host strains due to their reduced protease activity and compatibility with T7 promoter-based expression vectors. For optimal expression, the following conditions are recommended:

Table 1: Optimal Expression Conditions for Recombinant S. boydii arnC

ParameterRecommended ConditionNotes
Expression vectorpET-28a(+) or pET-SUMON-terminal His-tag or SUMO-tag enhances solubility
E. coli strainBL21(DE3) or Rosetta(DE3)Rosetta provides rare codons if needed
Induction temperature18-20°CLower temperature reduces inclusion body formation
Induction OD₆₀₀0.6-0.8Mid-log phase yields optimal expression
IPTG concentration0.1-0.3 mMLower concentrations favor soluble protein
Post-induction time16-18 hoursExtended time at lower temperature
Media compositionTB or 2×YT with 0.5% glucoseRicher media improves yield

The addition of 10% glycerol to lysis and purification buffers significantly improves protein stability. Furthermore, incorporating 1-2 mM DTT or 5 mM β-mercaptoethanol helps maintain the reduced state of cysteine residues. Membrane-associated proteins like arnC often benefit from the addition of mild detergents (0.05-0.1% Triton X-100) during purification steps to maintain proper folding and enzymatic activity .

How can researchers effectively purify recombinant arnC while maintaining its enzymatic activity?

Purification of recombinant S. boydii arnC presents challenges due to its association with membrane components and potential for aggregation. A multi-step purification strategy that preserves enzymatic activity is recommended:

  • Initial Clarification: After cell lysis (preferably using a French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 0.1% n-dodecyl-β-D-maltoside), centrifuge at 20,000×g for 30 minutes to remove cell debris.

  • Immobilized Metal Affinity Chromatography (IMAC): Apply the clarified lysate to a Ni-NTA column equilibrated with lysis buffer containing 20 mM imidazole. Wash extensively and elute with a gradient of 50-300 mM imidazole.

  • Buffer Exchange and Tag Removal: Dialyze against 50 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, and 0.05% n-dodecyl-β-D-maltoside. If using a SUMO or other cleavable tag, treat with the appropriate protease (e.g., ULP1 for SUMO tags).

  • Size Exclusion Chromatography: Apply the sample to a Superdex 200 column to achieve final purification and remove any aggregates.

Throughout purification, maintain a temperature of 4°C and include 1-2 mM DTT or TCEP to prevent oxidation. Activity assays performed after each purification step reveal that approximately 70-80% of the initial activity is retained following complete purification. Storage at -80°C in small aliquots with 20% glycerol preserves activity for up to 6 months .

What analytical methods are available for assessing the enzymatic activity of purified arnC?

Several complementary analytical methods can be employed to assess the enzymatic activity of purified arnC, each providing different insights into enzyme function:

Radiochemical Assay: This gold-standard method involves monitoring the transfer of [¹⁴C]-labeled 4-deoxy-4-formamido-L-arabinose from UDP-β-(4-deoxy-4-formamido-L-arabinose) to undecaprenyl phosphate. The reaction products are separated by thin-layer chromatography on silica gel plates using chloroform:methanol:water:ammonium hydroxide (65:25:3.6:0.4) as the mobile phase. Quantification is performed by phosphorimaging, with typical activity for pure enzyme ranging from 5-15 nmol/min/mg protein.

HPLC-Based Assay: High-performance liquid chromatography coupled with UV detection offers a non-radioactive alternative. The decrease in UDP-β-(4-deoxy-4-formamido-L-arabinose) or the appearance of UDP can be monitored at 262 nm using a C18 reverse-phase column with an acetonitrile gradient.

Coupled Enzymatic Assay: This method links the release of UDP from the arnC reaction to NADH oxidation through pyruvate kinase and lactate dehydrogenase, allowing continuous spectrophotometric monitoring at 340 nm. This approach is particularly useful for kinetic studies and inhibitor screening.

Table 2: Comparison of arnC Activity Assay Methods

MethodSensitivityThroughputEquipment RequirementsAdvantagesLimitations
RadiochemicalVery HighLowTLC, Radioisotope handlingDirect measurement, highest sensitivityRequires radioactive materials, low throughput
HPLCModerateModerateHPLC systemNo radioactivity, quantitativeRequires purified substrates, moderate sensitivity
Coupled EnzymaticModerateHighSpectrophotometerReal-time kinetics, adaptable to plate formatPotential interference from sample components

For the most comprehensive assessment, researchers should consider using multiple methods in parallel, particularly when characterizing novel arnC variants or testing potential inhibitors .

How does the crystal structure of arnC inform our understanding of its catalytic mechanism?

While the complete crystal structure of Shigella boydii arnC has not been fully resolved in the available literature, structural homology modeling based on related glycosyltransferases provides significant insights into its catalytic mechanism. The enzyme belongs to the GT-C superfamily of glycosyltransferases, characterized by multiple membrane-spanning domains and a catalytic domain with a DXD motif that coordinates a divalent metal ion, typically Mg²⁺ or Mn²⁺. This metal ion plays a crucial role in positioning the phosphate groups of the UDP-sugar donor for nucleophilic attack.

The predicted catalytic domain features a Rossmann-like fold typical of nucleotide-binding proteins, with parallel β-sheets flanked by α-helices. Site-directed mutagenesis studies have identified several conserved residues essential for catalysis, including:

  • Asp94 and Asp96 (part of the DXD motif): Coordinate the metal ion and position the UDP-sugar

  • His250: Likely functions as a catalytic base that activates the undecaprenyl phosphate hydroxyl group

  • Arg156 and Lys201: Form ionic interactions with the phosphate groups of the UDP-sugar

The enzyme is predicted to utilize an SN2-like displacement mechanism, where the undecaprenyl phosphate acts as a nucleophile to attack the C1 carbon of the sugar moiety, with the UDP group acting as the leaving group. This results in the formation of a β-glycosidic linkage in the product.

The hydrophobic nature of the undecaprenyl chain suggests the presence of a membrane-associated groove or tunnel in the enzyme that properly positions this substrate for the reaction. This structural feature explains why arnC activity is significantly reduced in detergent-solubilized preparations compared to membrane-associated forms .

What are the primary challenges in developing selective inhibitors of bacterial arnC for therapeutic applications?

Developing selective inhibitors of bacterial arnC presents several significant challenges that must be addressed for successful therapeutic development:

Structural Homology with Human Glycosyltransferases: Despite differences in substrate specificity, bacterial arnC shares structural features with human glycosyltransferases, particularly in the nucleotide-binding domain. This similarity creates a risk of cross-reactivity and potential toxicity, necessitating careful design to achieve bacterial selectivity.

Membrane Association: The membrane-associated nature of arnC complicates inhibitor development, as compounds must navigate the permeability barrier of the bacterial envelope while retaining sufficient hydrophilicity for solubility and bioavailability.

Substrate Complexity: The natural substrates of arnC—undecaprenyl phosphate and UDP-β-(4-deoxy-4-formamido-L-arabinose)—are structurally complex molecules that are challenging to mimic with small-molecule inhibitors. Additionally, the large binding interface between enzyme and substrates creates difficulties in identifying high-affinity competitive inhibitors.

Resistance Development: Bacteria can potentially develop resistance to arnC inhibitors through multiple mechanisms, including target modification, upregulation of efflux pumps, or utilization of alternative pathways for lipid A modification.

Current strategies to overcome these challenges include:

  • Fragment-based drug discovery focusing on the nucleotide-binding pocket

  • Transition-state analog design mimicking the reaction intermediate

  • Allosteric inhibitors targeting non-conserved regulatory sites

  • Covalent inhibitors targeting non-catalytic cysteine residues unique to bacterial enzymes

  • Combination approaches targeting multiple steps in the L-Ara4N modification pathway

Progress in this area could lead to novel adjuvant therapies that restore sensitivity to polymyxins in resistant gram-negative bacteria, addressing a critical need in antimicrobial development .

How do environmental conditions and regulatory networks affect arnC expression and activity in Shigella boydii?

The expression and activity of arnC in Shigella boydii are subject to sophisticated regulation that responds to environmental conditions and integrates with broader stress response networks. This regulation occurs at multiple levels:

Transcriptional Regulation: The arn operon, including arnC, is primarily regulated by the PmrA/PmrB and PhoP/PhoQ two-component systems. PmrB is activated by high Fe³⁺, Al³⁺, or low pH, while PhoQ responds to low Mg²⁺, antimicrobial peptides, or acidic pH. Upon activation, PmrA and PhoP bind to specific promoter elements upstream of the arn operon, enhancing transcription. Additionally, cross-talk between these systems occurs via the small connector protein PmrD, which can prevent dephosphorylation of PmrA.

Table 3: Environmental Signals and Regulatory Response for arnC Expression

Environmental SignalSensor ProteinResponse RegulatorEffect on arnC ExpressionPhysiological Context
Low Mg²⁺ (< 10 μM)PhoQPhoP → PmrD → PmrAStrong induction (15-20 fold)Macrophage phagosome
High Fe³⁺ (> 100 μM)PmrBPmrAModerate induction (8-12 fold)Environmental adaptation
Low pH (pH < 5.8)PhoQ and PmrBPhoP and PmrAStrong induction (15-25 fold)Gastrointestinal tract
Antimicrobial peptidesPhoQPhoP → PmrD → PmrAModerate induction (6-10 fold)Host defense evasion
QseBC activationQseCQseBRepression or interferenceSignal integration

Post-transcriptional Regulation: Small RNAs, including MicA and RprA, have been implicated in modulating the stability of arn operon mRNAs. Additionally, the RNA chaperone Hfq plays a role in facilitating these interactions and protecting the mRNA from degradation under specific conditions.

Post-translational Regulation: The activity of arnC may be modulated by membrane lipid composition, which affects enzyme conformation and substrate accessibility. Further, there is evidence for protein-protein interactions between arn pathway enzymes, suggesting the formation of a multi-enzyme complex that enhances pathway efficiency through substrate channeling.

Integration with Stress Responses: The arn pathway is integrated with broader bacterial stress responses, including envelope stress responses mediated by the Rcs phosphorelay system and the σE regulon. Mutations in undecaprenyl phosphate metabolism (such as in bacA, pgpB, ybjG) can trigger compensatory upregulation of the arn operon through these stress response systems.

The QseBC two-component system has emerged as an important modulator of arn pathway function, with perturbations in QseC leading to cell enlargement and lysis, potentially through dysregulation of cell wall synthesis pathways including L-Ara4N modification. Interestingly, deletion of qseB reverses these shape defects, suggesting complex regulatory interactions that impact bacterial cell integrity .

What are the current limitations in studying the kinetics and substrate specificity of arnC?

Research on arnC kinetics and substrate specificity faces several significant challenges that limit our comprehensive understanding of this enzyme:

Substrate Availability: Both primary substrates—undecaprenyl phosphate and UDP-β-(4-deoxy-4-formamido-L-arabinose)—are not commercially available and must be synthesized through complex multi-step processes. The undecaprenyl phosphate is particularly challenging due to its hydrophobicity and tendency to form micelles, making accurate concentration determination difficult.

Membrane Association: ArnC is naturally associated with the bacterial membrane, and detergent solubilization often results in reduced activity and altered kinetic parameters. Reconstitution systems using liposomes or nanodiscs improve activity but introduce variables that complicate kinetic analysis, including substrate partitioning into the lipid phase and potential orientation effects.

Coupled Reaction Systems: In vivo, arnC functions as part of a multi-enzyme pathway, with potential substrate channeling between pathway components. Isolated enzyme studies may not accurately reflect the natural kinetics when the enzyme functions within this complex.

Analytical Limitations: Monitoring the formation of undecaprenyl phosphate-linked 4-deoxy-4-formamido-L-arabinose requires specialized analytical techniques. Direct continuous assays are challenging, often necessitating discontinuous assays that provide less detailed kinetic information.

Table 4: Current Approaches and Limitations in arnC Kinetic Studies

ApproachAdvantagesLimitationsTypical Results
Detergent-solubilized enzymeSimple preparation, homogeneous systemReduced activity, potential detergent effectsK<sub>m</sub> (UDP-L-Ara4N-formyl) = 25-40 μM, k<sub>cat</sub> = 0.5-2 min<sup>-1</sup>
Nanodisc-reconstituted enzymeNear-native environment, defined systemComplex preparation, potential orientation effectsK<sub>m</sub> (UDP-L-Ara4N-formyl) = 8-15 μM, k<sub>cat</sub> = 3-7 min<sup>-1</sup>
Membrane vesicle preparationNative environment maintainedMixed enzyme population, difficult quantificationApparent K<sub>m</sub> = 5-10 μM, Relative V<sub>max</sub> only
Whole-cell activity measurementsPhysiologically relevantIndirect measurement, multiple variablesQualitative comparison only

Addressing these limitations requires developing improved synthetic methods for substrate preparation, establishing more sophisticated membrane mimetic systems, and developing more sensitive and direct analytical methods for product detection .

How does arnC function differ between in vitro systems and in vivo bacterial environments?

The function of arnC exhibits significant differences between controlled in vitro systems and the complex in vivo bacterial environment, with important implications for research interpretation and drug development:

Substrate Concentrations and Availability: In vivo, the concentration of undecaprenyl phosphate is strictly regulated and limited, as this carrier lipid is shared among multiple essential pathways including peptidoglycan, O-antigen, and teichoic acid biosynthesis. This creates competition that is rarely recapitulated in vitro, where optimal substrate concentrations are typically used. The cellular concentration of undecaprenyl phosphate is estimated at 0.5-5 μM, well below the saturating conditions often used in vitro.

Membrane Environment: The bacterial inner membrane provides a specific lipid environment that affects arnC folding, orientation, and activity. The lipid composition—particularly the presence of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin—impacts enzyme function in ways that are difficult to reproduce with detergent-solubilized systems or even simple liposome reconstitutions.

Protein-Protein Interactions: In vivo evidence suggests that arnC functions within a multi-enzyme complex including other Arn pathway proteins. These interactions may facilitate substrate channeling, wherein the product of one enzyme is directly transferred to the next enzyme without equilibration with the bulk solution. Such channeling can significantly enhance pathway efficiency and is rarely captured in isolated enzyme studies.

Metabolic Feedback: The L-Ara4N modification pathway is integrated with broader bacterial metabolism, including connections to central carbon metabolism through sugar nucleotide synthesis pathways. In vivo, flux through the pathway may be influenced by metabolic bottlenecks or feedback mechanisms that are absent in reconstituted systems.

Temporal Regulation: Under inducing conditions in vivo, the expression and activity of arnC are dynamically regulated in coordination with bacterial growth phase and stress responses. This temporal regulation is typically not addressed in standardized in vitro assays.

These differences highlight the importance of complementary approaches, combining detailed in vitro mechanistic studies with whole-cell and genetic approaches that capture the physiological context. Advanced techniques such as in-cell NMR, cryoelectron tomography, and single-molecule microscopy are beginning to bridge this gap by providing molecular-level information within the cellular context .

What emerging technologies could advance our understanding of arnC structure-function relationships?

Several cutting-edge technologies show promise for overcoming current limitations in studying arnC structure-function relationships:

Cryo-Electron Microscopy: Recent advances in cryo-EM technology enable the structural determination of membrane proteins without crystallization. Application to arnC could reveal its native conformation within the membrane environment, particularly when coupled with lipid nanodisc reconstitution. Single-particle cryo-EM can potentially achieve near-atomic resolution, while cryo-electron tomography could visualize arnC in the context of native membranes or multi-enzyme complexes.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides information about protein dynamics and ligand interactions by measuring the rate of hydrogen-deuterium exchange in different regions of the protein. For arnC, HDX-MS could identify substrate-binding regions, conformational changes upon substrate binding, and potential allosteric sites, even in membrane-associated states where traditional structural methods are challenging.

Integrative Structural Biology: Combining multiple experimental approaches (X-ray crystallography, NMR, SAXS, crosslinking-MS) with computational modeling can generate comprehensive structural models. For arnC, this could involve solving structures of individual domains and constructing a full model through integrative methods, validated by functional studies.

Genetic Code Expansion and Bio-orthogonal Chemistry: These approaches allow the site-specific incorporation of unnatural amino acids with unique chemical properties. For arnC, photocrosslinking amino acids could trap transient enzyme-substrate complexes, while spectroscopic probes could monitor conformational changes during catalysis.

Table 5: Emerging Technologies for arnC Structure-Function Studies

TechnologyApplication to arnCExpected InsightsCurrent Limitations
Cryo-EMStructure determination in lipid environmentNative conformation, substrate binding sitesSample preparation challenges, protein size
HDX-MSDynamics and ligand interactionsConformational changes, allosteric networksMembrane protein analysis still developing
AlphaFold2/RoseTTAFoldComputational structure predictionInitial structural models to guide experimentsLimited accuracy for membrane proteins
Site-directed fluorescenceConformational changesReal-time monitoring of catalytic cycleRequires specific labeling strategies
Nanodiscs with defined lipid compositionNative-like membrane environmentLipid-protein interactions, orientation effectsComplex preparation, heterogeneity

Synthetic Biology Approaches: Engineering minimal bacterial systems with controlled expression of arnC and related pathway components could create simplified in vivo models for studying enzyme function. CRISPR interference (CRISPRi) and optogenetic tools offer precise spatial and temporal control of gene expression to dissect pathway dynamics.

Advanced Computational Methods: Recent advances in AlphaFold2 and related deep learning approaches are improving predictions of membrane protein structures. Molecular dynamics simulations incorporating membrane environments can provide insights into enzyme dynamics and substrate interactions that are difficult to capture experimentally.

The integration of these technologies promises to provide unprecedented insights into how arnC functions within its native membrane environment, how it recognizes and processes its substrates, and how this activity might be effectively targeted for therapeutic development .

How have arnC homologs evolved across different bacterial pathogens, and what implications does this have for antimicrobial resistance?

The evolutionary trajectory of arnC homologs across diverse bacterial pathogens reveals important insights into the acquisition, conservation, and diversification of antimicrobial resistance mechanisms:

Sequence Conservation: Within the Enterobacteriaceae family, arnC homologs typically share 85-95% amino acid sequence identity, with the catalytic domains showing the highest conservation. Critical residues involved in substrate binding and catalysis are nearly invariant, reflecting strong selective pressure to maintain enzymatic function. In contrast, regions involved in membrane association and protein-protein interactions show greater variability, potentially reflecting adaptation to different membrane environments or pathway organizations.

Domain Architecture: While the core catalytic domain of arnC is highly conserved, some bacterial species possess extended N-terminal or C-terminal regions that may confer additional regulatory functions or protein interaction capabilities. For example, arnC homologs in Pseudomonas aeruginosa contain extended N-terminal regions compared to their Enterobacteriaceae counterparts, potentially reflecting differences in membrane topology or regulatory mechanisms.

Horizontal Gene Transfer: Phylogenetic incongruence between arnC gene trees and species trees suggests that horizontal gene transfer has played a role in the dissemination of the arn pathway. Multiple independent acquisition events appear to have occurred, particularly in hospital-adapted pathogens. Mobilizable genetic elements containing arn genes have been identified in clinically relevant species, raising concerns about the rapid spread of polymyxin resistance.

Selective Pressure: The rise in colistin (polymyxin E) use as a last-resort antibiotic has created strong selective pressure favoring the maintenance and optimization of the arn pathway. Increased prevalence of constitutive arn expression through mutations in regulatory systems has been observed in clinical isolates exposed to polymyxin therapy, highlighting the evolutionary adaptability of this resistance mechanism.

Functional Divergence: Despite sequence conservation, subtle functional differences exist between arnC homologs from different species. These include differences in substrate specificity, catalytic efficiency, and responses to environmental signals. Such differences may contribute to species-specific variations in the level of polymyxin resistance and cross-resistance to other antimicrobial peptides.

The evolutionary patterns of arnC hold several implications for antimicrobial resistance and therapeutic development:

  • The high conservation of catalytic mechanisms suggests that broad-spectrum inhibitors targeting arnC might be effective against multiple pathogens.

  • Variations in regulatory mechanisms point to species-specific strategies for countering resistance induction.

  • The capacity for horizontal transfer highlights the need for surveillance and stewardship to prevent resistance spread.

  • Understanding the selective pressures driving arnC evolution may help predict and counter future resistance mechanisms .

What methodological approaches can researchers use to investigate the role of arnC in host-pathogen interactions during Shigella infection?

Investigating the role of arnC in host-pathogen interactions during Shigella infection requires a multifaceted approach that spans molecular, cellular, and in vivo levels of analysis:

Genetic Manipulation Strategies:

  • CRISPR-Cas9 genome editing can generate precise deletions or point mutations in arnC to assess its contribution to virulence.

  • Complementation studies with wild-type or catalytically inactive variants can confirm phenotype specificity.

  • Conditional knockdown systems (e.g., CRISPRi or inducible antisense RNA) allow temporal control of arnC expression during different infection stages.

  • Reporter fusions (e.g., arnC-GFP) can monitor expression patterns during infection.

In Vitro Infection Models:

  • Tissue culture invasion assays using epithelial cell lines (e.g., Caco-2, HT-29) can assess the impact of arnC manipulation on bacterial invasion efficiency.

  • Macrophage survival assays using THP-1 or RAW 264.7 cells can determine the role of arnC in resisting intracellular killing mechanisms.

  • Transwell systems with polarized epithelial monolayers can evaluate effects on barrier disruption and transepithelial migration.

  • Co-culture systems incorporating multiple cell types (epithelial cells, macrophages, dendritic cells) provide more physiologically relevant contexts.

Ex Vivo Approaches:

  • Human intestinal organoids derived from stem cells recapitulate the complexity of the intestinal epithelium, offering a sophisticated model for studying Shigella pathogenesis.

  • Precision-cut intestinal slices maintain tissue architecture and cellular diversity.

  • Explanted human or primate colonic tissue in organ culture systems allows short-term infection studies in near-native environments.

In Vivo Models:

  • Guinea pig keratoconjunctivitis (Serény test) assesses the contribution of arnC to Shigella virulence.

  • Mouse pulmonary infection models, while not recapitulating intestinal disease, allow assessment of inflammatory responses.

  • Humanized mouse models with engrafted human immune cells or tissues provide closer approximation to human disease.

  • Non-human primate models of bacillary dysentery, though ethically complex and resource-intensive, most accurately reflect human shigellosis.

Table 6: Comparative Analysis of Host-Pathogen Interaction Models for arnC Studies

Model SystemAdvantagesLimitationsKey Readouts for arnC Studies
Tissue culture (epithelial)Simple, controlled, high-throughputLacks tissue complexityInvasion efficiency, cytokine induction, antimicrobial peptide resistance
Macrophage infectionAssesses intracellular survivalLimited physiological relevanceSurvival in phagolysosome, inflammasome activation
Intestinal organoids3D structure, multiple cell typesTechnical complexity, variabilityEpithelial response, tissue invasion patterns
Guinea pig Serény testIn vivo virulence assessmentLimited immunological toolsInflammation intensity, bacterial persistence
Non-human primateMost physiologically relevantEthical considerations, costDisease progression, immune response, bacterial burden

Molecular and Cellular Readouts:

  • Antimicrobial peptide susceptibility testing with host-derived defensins and cathelicidins

  • Immunofluorescence microscopy to visualize host defense peptide binding to bacterial surfaces

  • Flow cytometry to assess complement deposition and phagocytosis efficiency

  • RNA-seq of both pathogen and host to capture transcriptional responses

  • Quantitative lipidomics to assess LPS/lipid A modifications during infection

  • Immunological assays measuring TLR4 activation by modified versus unmodified lipid A

Advanced Imaging Approaches:

  • Intravital microscopy in animal models to visualize bacterial-host interactions in real-time

  • Super-resolution microscopy to examine subcellular localization of arnC during infection

  • Correlative light and electron microscopy to link arnC expression with ultrastructural features

The integration of these methodological approaches can provide comprehensive insights into how arnC-mediated lipid A modifications influence the complex interplay between Shigella and its host during infection, potentially revealing new therapeutic opportunities .

How can systems biology approaches be applied to understand the broader metabolic context of arnC function in bacterial resistance networks?

Systems biology approaches offer powerful frameworks for understanding arnC function within the broader context of bacterial metabolism and resistance networks:

Multi-omics Integration:
Combining multiple data types provides a comprehensive view of how arnC functions within cellular networks:

  • Transcriptomics can identify co-regulated genes and regulatory networks controlling arnC expression

  • Proteomics reveals post-transcriptional regulation and protein-protein interactions involving arnC

  • Metabolomics tracks substrate and product levels, identifying potential metabolic bottlenecks

  • Lipidomics characterizes changes in membrane composition that may influence arnC function

  • Fluxomics measures metabolic flux through the L-Ara4N pathway under different conditions

Integration of these datasets requires sophisticated computational approaches but can reveal emergent properties not apparent from individual analyses. For example, correlation network analysis of transcriptomic and metabolomic data has identified previously unknown connections between the arn pathway and central carbon metabolism in polymyxin-resistant Klebsiella pneumoniae isolates.

Genome-Scale Metabolic Modeling:
Constraint-based modeling approaches such as Flux Balance Analysis (FBA) can predict how arnC activity impacts broader metabolic networks:

  • Incorporation of the arn pathway into genome-scale metabolic models of Shigella and related pathogens

  • Simulation of metabolic flux distributions under different growth conditions and antimicrobial stresses

  • Identification of synthetic lethal interactions that could guide combination therapy approaches

  • Prediction of metabolic vulnerabilities created by upregulation of the arn pathway

Table 7: Predicted Metabolic Shifts Associated with arnC Upregulation

Metabolic PathwayPredicted ChangeMechanistic BasisPotential Therapeutic Implications
Nucleotide metabolismIncreased UDP consumptionSubstrate requirementSynergy with nucleotide biosynthesis inhibitors
TCA cycleReduced fluxResource diversionEnergy-targeting adjuvants
Pentose phosphate pathwayIncreased fluxNADPH requirementOxidative stress sensitization
Fatty acid biosynthesisAltered compositionMembrane adaptationMembrane-targeting combination therapy
Folate metabolismIncreased fluxFormyl group requirementAntifolate synergy

Network Analysis of Genetic Interactions:
High-throughput genetic approaches provide insights into functional interactions:

  • Transposon insertion sequencing (Tn-Seq) under polymyxin selection identifies genes that interact with the arn pathway

  • Systematic gene deletion studies reveal synthetic lethal and synthetic sick interactions

  • Chemical-genetic profiling identifies compounds that show synergy with arn pathway inhibition

  • Suppressor screens identify compensatory mechanisms that may arise following arn pathway inhibition

Regulatory Network Reconstruction:
Understanding the complex regulation of arnC requires mapping its regulatory context:

  • ChIP-seq to identify direct transcription factor binding sites in the arn operon promoter

  • DNase-seq to map changes in chromatin accessibility under different conditions

  • RNA-seq time-course experiments to capture dynamic regulatory responses

  • Network inference algorithms to reconstruct regulatory hierarchies from gene expression data

Dynamic Modeling of Resistance Development:
Mathematical modeling can capture the population dynamics of resistance:

  • Ordinary differential equation models of the kinetics of L-Ara4N modification

  • Agent-based models of population heterogeneity in resistance phenotypes

  • Evolutionary game theory approaches to predict resistance development under different treatment regimens

The application of these systems biology approaches has already yielded important insights, revealing that the arn pathway does not function in isolation but is embedded within a complex network of metabolic and regulatory interactions. For example, recent studies have identified unexpected connections between arnC activity and glutathione metabolism, with glutathione depletion sensitizing bacteria to polymyxins even in strains with active L-Ara4N modification systems. Such insights provide new avenues for developing adjuvant therapies that target these interconnections to overcome polymyxin resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.