Recombinant Shigella boydii serotype 4 Universal stress protein B (uspB)

What is Shigella boydii and how does it relate to other Shigella species?

Shigella boydii is one of four species within the Shigella genus, alongside S. dysenteriae, S. flexneri, and S. sonnei. First discovered in 1897, Shigella are Gram-negative, non-spore-forming, non-motile, facultative aerobic, rod-shaped bacteria that cause disease specifically in primates, including humans and gorillas, but not in other mammals . The genus is closely related to Escherichia coli and represents one of the leading bacterial causes of diarrhea worldwide, particularly affecting children in African and South Asian regions . While S. flexneri is the most frequently isolated species globally (accounting for approximately 60% of cases), understanding S. boydii remains crucial for comprehensive Shigella research .

What is Universal stress protein B (uspB) and what is its general function in Shigella?

Universal stress protein B (uspB) is a conserved bacterial protein expressed under various stress conditions. In Shigella, uspB is part of the stress response mechanism that helps the bacterium survive hostile environments encountered during infection. The protein consists of 111 amino acids, as demonstrated in the recombinant proteins derived from Shigella boydii strain CDC 3083-94/BS512 and Shigella dysenteriae serotype 1 . The amino acid sequence for S. dysenteriae uspB is: "MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQVRLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH" . This sequence provides researchers with valuable information for comparative analyses across Shigella species and serotypes.

How should recombinant Shigella uspB proteins be stored and handled in laboratory settings?

For optimal stability and activity, recombinant Shigella uspB proteins should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be minimized . Before opening, vials should be briefly centrifuged to ensure all content settles at the bottom.

For reconstitution, researchers should use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being standard) is recommended for long-term storage . The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . These handling protocols maximize protein stability and experimental reproducibility.

What expression systems are most effective for producing recombinant Shigella boydii uspB?

Recombinant Shigella boydii uspB can be successfully expressed in several systems, including E. coli, yeast, baculovirus, or mammalian cells . E. coli expression systems are most commonly employed due to their cost-effectiveness and high yield, as demonstrated by the commercially available recombinant S. dysenteriae uspB protein expressed in E. coli with an N-terminal His tag .

When designing expression constructs, researchers should consider:

• Codon optimization for the chosen expression system

• Inclusion of appropriate tags (such as His-tag) for purification

• Selection of promoters that provide controlled expression levels

• Consideration of the protein's native characteristics when selecting fusion partners

The choice between prokaryotic and eukaryotic expression systems should be guided by the specific research questions and the need for post-translational modifications.

What purification strategies yield the highest purity for recombinant Shigella uspB proteins?

Effective purification of recombinant Shigella uspB typically employs affinity chromatography as the initial capture step. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is the method of choice . The purification protocol should include:

• Cell lysis under conditions that maintain protein solubility

• Initial capture with affinity chromatography

• Intermediate purification using ion exchange chromatography

• Polishing step with size exclusion chromatography

This multi-step approach can achieve purity levels greater than 90% as determined by SDS-PAGE . Researchers should carefully optimize buffer conditions during each step to maintain protein stability and activity. The final product is typically prepared as a lyophilized powder to ensure long-term stability .

What are the methodological approaches for elucidating the structure-function relationship of Shigella boydii uspB?

Investigating the structure-function relationship of Shigella boydii uspB requires a multi-faceted approach:

• X-ray crystallography or cryo-EM: These techniques provide atomic-level resolution of protein structure, though crystallization of membrane-associated proteins like uspB can be challenging.

• NMR spectroscopy: Particularly useful for examining protein dynamics and ligand interactions in solution.

• Site-directed mutagenesis: Systematic alteration of specific amino acids helps identify residues crucial for function, particularly focusing on:

  • The highly conserved regions across Shigella species

  • Residues involved in stress response signaling

  • Potential membrane interaction domains

• Functional assays: Measuring uspB activity under various stress conditions (oxidative stress, pH changes, antimicrobial exposure) to correlate structural features with functional responses.

• Computational modeling: Using homology modeling and molecular dynamics simulations to predict structural features and dynamic behaviors, particularly useful when comparing uspB across different Shigella serotypes.

The experimental design should include proper controls and address potential data contradictions that may emerge when comparing results across different methodologies.

How can researchers distinguish the functional roles of uspB from other universal stress proteins in Shigella species?

Distinguishing the specific functions of uspB from other universal stress proteins requires careful experimental design:

• Gene knockout and complementation studies:

  • Create uspB-specific knockout strains

  • Complement with wild-type uspB or other USP family members

  • Assess phenotypic changes under various stress conditions

• Transcriptomic and proteomic profiling:

  • Compare expression patterns of all USP family members under different stresses

  • Identify unique expression signatures for uspB

  • Use RNA-seq and mass spectrometry to detect subtle differences in regulation

• Protein-protein interaction studies:

  • Employ pull-down assays, yeast two-hybrid, or proximity labeling techniques

  • Map uspB-specific interaction networks

  • Compare interactomes across different USP family members

• In vivo infection models:

  • Test uspB mutants in appropriate animal models

  • Assess colonization, persistence, and virulence

  • Compare with other USP family member mutants

This methodological framework helps resolve contradictory findings that often emerge when studying protein families with potentially redundant functions.

What experimental approaches can determine the role of uspB in Shigella boydii pathogenesis?

To investigate uspB's role in Shigella boydii pathogenesis, researchers should implement a multi-level experimental approach:

• Invasion assays using epithelial cell lines:

  • Compare wild-type and uspB-deficient strains

  • Quantify invasion efficiency using gentamicin protection assays

  • Assess intracellular replication rates

• Macrophage survival assays:

  • Evaluate survival within macrophages

  • Measure inflammatory cytokine production

  • Assess macrophage cell death mechanisms

• Animal infection models:

  • Guinea pig keratoconjunctivitis (Sereny test)

  • Mouse pulmonary infection model

  • Primate intestinal infection (for most relevant pathogenesis data)

• Transcriptional regulation studies:

  • Identify environmental signals that trigger uspB expression during infection

  • Map regulatory networks controlling uspB expression

  • Analyze promoter activity under host-relevant conditions

• In vivo imaging:

  • Track uspB expression during infection using reporter constructs

  • Visualize uspB protein localization during pathogenesis

How does uspB contribute to stress response and antimicrobial resistance in Shigella?

The relationship between uspB and stress response/antimicrobial resistance can be investigated through:

• Minimum inhibitory concentration (MIC) testing:

  • Compare antimicrobial susceptibility between wild-type and uspB mutants

  • Test across multiple antibiotic classes

  • Evaluate under various environmental stress conditions

• Stress survival assays:

  • Expose bacteria to oxidative stress, acid stress, bile salts, etc.

  • Measure survival rates and recovery times

  • Correlate uspB expression levels with survival outcomes

• Gene expression studies:

  • Analyze changes in global gene expression in uspB mutants

  • Identify potential regulatory connections to known resistance mechanisms

  • Map stress response pathways influenced by uspB

• Proteomic analysis:

  • Identify changes in outer membrane protein composition

  • Detect alterations in efflux pump expression

  • Analyze lipopolysaccharide modifications

Recent findings in S. flexneri have demonstrated that antimicrobial resistance profiles can shift during bacterial evolution, with some resistance genes being lost while others are retained . Similar dynamics may occur with stress response proteins like uspB, potentially affecting bacterial fitness and pathogenicity.

What bioinformatic approaches should be used to analyze uspB conservation and evolution across Shigella serotypes?

To comprehensively analyze uspB conservation and evolution, researchers should employ:

• Sequence alignment and phylogenetic analysis:

  • Multiple sequence alignment of uspB across all Shigella serotypes

  • Construction of phylogenetic trees using maximum likelihood methods

  • Calculation of selection pressures (dN/dS ratios) to identify evolutionary constraints

• Structural prediction and comparison:

  • Homology modeling of uspB proteins from different serotypes

  • Identification of conserved structural motifs

  • Prediction of functional sites based on structural conservation

• Genomic context analysis:

  • Examination of uspB gene neighborhood across Shigella genomes

  • Identification of synteny patterns or genomic rearrangements

  • Analysis of mobile genetic elements that may influence uspB evolution

• Population genomics:

  • Analysis of uspB variation in clinical isolates

  • Identification of lineage-specific adaptations

  • Correlation with epidemiological data and virulence profiles

Research on S. flexneri has revealed that genetic changes, including single nucleotide polymorphisms affecting multiple genes and amino acid substitutions in outer membrane proteins, can significantly impact bacterial fitness and pathogenicity . Similar evolutionary dynamics may occur with uspB across different Shigella serotypes.

How can researchers address contradictions in experimental findings related to uspB function across Shigella species?

When confronting contradictory findings regarding uspB function, researchers should:

• Standardize experimental conditions:

  • Develop uniform protocols for uspB expression and purification

  • Establish standardized stress conditions and assay parameters

  • Create reference strains accessible to the research community

• Employ multi-laboratory collaborative studies:

  • Engage multiple research teams to independently test the same hypotheses

  • Pool raw data for meta-analysis

  • Identify sources of variability in experimental outcomes

• Integrate computational and experimental approaches:

  • Use computational predictions to guide targeted experiments

  • Validate in silico findings with in vitro and in vivo studies

  • Develop mathematical models to reconcile seemingly contradictory results

• Consider contextual dependencies:

  • Evaluate uspB function in the context of genetic background

  • Assess environmental factors that may alter protein function

  • Examine host-pathogen interactions that influence uspB activity

As highlighted in recent studies, confirmation bias can significantly influence data interpretation, with researchers who expect certain trends being more likely to report detecting them . This underscores the importance of blinded analysis and collaborative approaches when investigating proteins like uspB, whose functions may be subtle and context-dependent.

What are the methodological considerations for designing CRISPR-Cas9 based modifications of uspB in Shigella boydii?

When designing CRISPR-Cas9 modifications of uspB in Shigella boydii, researchers should consider:

• Guide RNA design:

  • Select highly specific target sequences to minimize off-target effects

  • Account for Shigella's AT-rich genome when designing gRNAs

  • Validate gRNA efficiency in silico before experimental implementation

• Delivery methods:

  • Optimize electroporation protocols specific for Shigella boydii

  • Consider conjugation-based delivery for strains resistant to transformation

  • Develop temperature-sensitive plasmids for transient expression

• Editing strategies:

  • For knockout studies: design repair templates with selectable markers

  • For point mutations: incorporate silent mutations to prevent re-cutting

  • For tag insertion: ensure fusion proteins maintain native function

• Screening and validation:

  • Develop PCR-based screening methods for identifying successful edits

  • Confirm genomic modifications through sequencing

  • Validate phenotypic consequences using appropriate stress response assays

• Control for polar effects:

  • Design modifications that minimize impact on downstream genes

  • Include complementation controls to confirm phenotype specificity

  • Consider conditional expression systems for essential gene modifications

This methodological framework enables precise genetic manipulation of uspB while minimizing experimental artifacts that could lead to data misinterpretation.

What experimental design approaches can help resolve contradictions in uspB function data?

To address contradictions in uspB functional data, researchers should implement:

• Multifactorial experimental designs:

  • Systematically vary multiple experimental parameters

  • Employ factorial designs to identify interaction effects

  • Use response surface methodology to optimize experimental conditions

• Reproducibility-focused protocols:

  • Implement blinded analysis to minimize confirmation bias

  • Pre-register experimental designs and analysis plans

  • Share raw data and detailed methods to enable independent verification

• Integrative approaches:

  • Combine multiple independent techniques to address the same question

  • Correlate in vitro findings with in vivo observations

  • Use orthogonal methods to validate key findings

• Statistical rigor:

  • Perform power calculations to ensure adequate sample sizes

  • Apply appropriate statistical methods for testing hypotheses

  • Report effect sizes alongside statistical significance

• Contextual validation:

  • Test uspB function under conditions that mimic the host environment

  • Examine temporal dynamics of uspB activity during infection

  • Consider strain-specific and serotype-specific variations