Recombinant Shigella boydii serotype 4 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

Overview of Shigella boydii and its Virulence

Shigella boydii is a species of Shigella, a genus of Gram-negative bacteria that causes shigellosis, also known as bacillary dysentery, a severe form of gastroenteritis in humans . Shigella species, including S. boydii, are facultative intracellular pathogens that invade the intestinal mucosa, leading to inflammation, diarrhea, and abdominal pain . The evolution of Shigella involves the acquisition of virulence plasmids, which encode genes essential for their pathogenicity . These plasmids and other mobile genetic elements contribute to the bacteria's adaptation to the human intestinal environment .

Role of Outer Membrane Vesicles (OMVs) in Shigella

Shigella species secrete outer membrane vesicles (OMVs), which are nanoscale structures formed from the bacterial outer membrane, containing various virulence factors and immunogenic proteins . These OMVs play a crucial role in bacterial communication, nutrient acquisition, and pathogenesis . OMVs are also promising targets for vaccine development due to their ability to induce immune responses .

Multi-Serotype Outer Membrane Vesicles (MOMVs) for Broad Protection

Multi-serotype outer membrane vesicles (MOMVs) are formulations that combine OMVs from multiple Shigella serotypes to achieve broad-spectrum protection against shigellosis . Immunization with MOMVs has shown potential in inducing a broad antibody response and providing passive protection to offspring against various Shigella strains .

YfbV: A UPF0208 Family Outer Membrane Protein

YfbV is an outer membrane protein belonging to the UPF0208 (Unknown Protein Function) family. While the precise function of YfbV in Shigella boydii is not well-defined, studies on Shigella flexneri have provided insights into the roles of related proteins . In S. flexneri, YfiB, a homolog of YfbV, regulates the activity of the diguanylate cyclase YfiN, which controls the levels of cyclic di-GMP (c-di-GMP), a secondary messenger involved in bacterial virulence .

YfbV and Regulation of c-di-GMP Levels

The protein YfiB regulates YfiN (DGC) activity, thereby controlling c-di-GMP levels in the bacteria, which is indispensable for S. flexneri's ability to cause an effective infection in the host .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; SBO_2330; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sbo:SBO_2330

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0208 membrane protein YfbV and what is its significance in Shigella species?

UPF0208 membrane protein YfbV (yfbV) is a conserved membrane protein found in various Shigella species including S. flexneri and S. boydii. While the specific function of YfbV remains under investigation, it belongs to the UPF (Uncharacterized Protein Family) class of proteins, which are conserved across bacterial species, suggesting evolutionary importance. The protein consists of 151 amino acids in S. flexneri serotype 5b . The conservation of this protein across different Shigella species makes it potentially valuable for comparative studies of membrane protein function and pathogenicity factors .

The significance of studying YfbV lies in understanding its potential role in Shigella virulence mechanisms, as Shigella remains a leading cause of dysentery worldwide. Different Shigella species employ various virulence mechanisms, and characterizing proteins like YfbV may contribute to understanding their pathogenicity differences .

How is recombinant YfbV protein typically expressed and purified for research applications?

Recombinant YfbV protein can be expressed and purified from several different host systems. The most common expression systems include:

  • E. coli expression system: This provides the highest yields and shortest turnaround times. For YfbV protein, E. coli is commonly used with an N-terminal His-tag for purification purposes .

  • Yeast expression system: Also offers good yields and relatively short production times compared to more complex eukaryotic systems .

  • Insect cell/baculovirus expression system: While lower yielding, this system can provide some post-translational modifications that might be necessary for proper protein folding .

  • Mammalian cell expression system: Used when extensive post-translational modifications are required to maintain protein activity .

For YfbV specifically, purification typically involves:

  • Expression in E. coli with an N-terminal His-tag

  • Protein extraction and purification via affinity chromatography

  • Final preparation as a lyophilized powder

The standard purification protocol achieves greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant YfbV protein?

For optimal stability and activity retention, recombinant YfbV protein should be stored according to these guidelines:

  • Long-term storage: Store at -20°C or preferably -80°C upon receipt

  • Storage buffer: Typically maintained in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Aliquoting: Essential for multiple uses to prevent repeated freeze-thaw cycles which can degrade the protein

  • Working aliquots: Can be stored at 4°C for up to one week

  • Reconstitution: Should be performed using deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Glycerol addition: Addition of 5-50% glycerol (final concentration) is recommended for long-term storage, with 50% being standard practice

Proper sample handling is critical as repeated freezing and thawing significantly reduces protein stability and activity .

What are the challenges in expressing and purifying functional YfbV protein, and how can they be addressed?

Expressing and purifying functional membrane proteins like YfbV presents several significant challenges:

  • Membrane protein solubility: As an integral membrane protein, YfbV is hydrophobic and can form aggregates during expression.

    • Solution: Use of appropriate detergents during purification or fusion with solubility-enhancing tags

  • Maintaining native conformation: Ensuring the recombinant protein retains its native structure.

    • Solution: Expression in hosts that provide appropriate post-translational modifications; insect or mammalian cells may better preserve functionality compared to E. coli

  • Purification efficiency: Membrane proteins often yield lower quantities during purification.

    • Solution: Optimization of expression conditions, including temperature reduction during induction and use of specialized E. coli strains designed for membrane protein expression

  • Protein stability: YfbV may have limited stability following purification.

    • Solution: Addition of glycerol (5-50%) to storage buffer and maintaining strict storage conditions at -20°C/-80°C with minimal freeze-thaw cycles

  • Functional verification: Confirming that the purified protein retains biological activity.

    • Solution: Development of specific functional assays that can assess membrane insertion and protein-protein interactions

The choice of expression system significantly impacts these challenges. While E. coli provides higher yields and faster production, eukaryotic systems may preserve structural integrity better for certain applications .

How might YfbV contribute to Shigella pathogenicity and virulence mechanisms?

While the specific role of YfbV in Shigella pathogenicity has not been definitively characterized, we can make informed hypotheses based on Shigella virulence mechanisms:

Shigella pathogenicity involves several key steps:

  • Survival during transit through the gastrointestinal tract

  • Competition with host microbiota

  • Crossing the intestinal mucus layer

  • Invasion of host epithelial cells

  • Manipulation of host immune responses

As a membrane protein, YfbV may potentially contribute to:

  • Membrane integrity: YfbV might play a role in maintaining bacterial membrane structure during environmental stress conditions encountered during infection.

  • Nutrient acquisition: It could function in transport systems that facilitate nutrient uptake during competition with host microbiota.

  • Signaling pathways: YfbV might participate in signaling cascades that regulate expression of other virulence factors.

  • Host interaction: The protein could potentially interact with host factors during the infection process.

Comparative studies among different Shigella species have revealed significant diversity in virulence mechanisms . Most studies have used S. flexneri as a model organism, but other Shigella groups may exploit different virulence strategies. High-throughput technologies now offer opportunities to investigate protein-specific virulence features across different Shigella groups .

The epidemiological patterns of Shigella species have shifted over time, with S. sonnei increasing in prevalence relative to S. flexneri in regions with improved water sanitation . Understanding the potential contributions of membrane proteins like YfbV to these epidemiological shifts requires further investigation.

What methodologies are most effective for studying YfbV protein-protein interactions in Shigella?

Several complementary methodologies are effective for studying YfbV protein-protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Involves using antibodies against YfbV to precipitate the protein along with any interacting partners

    • Most effective when combined with western blotting or mass spectrometry to identify binding partners

    • Requires high-quality antibodies specific to YfbV

  • Chromatin Immunoprecipitation (ChIP) techniques:

    • Useful if studying potential DNA-binding properties or transcriptional complexes

    • ChIP-chip techniques as described in source could be adapted for YfbV studies

    • Involves cross-linking proteins to DNA, immunoprecipitation, and analysis by microarray or sequencing

  • Bacterial Two-Hybrid (B2H) screening:

    • Allows systematic screening for potential protein-protein interactions

    • Particularly useful for membrane proteins as it occurs in a bacterial cellular environment

    • Can identify novel interaction partners through library screening

  • Microscopy-based approaches:

    • Fluorescence Resonance Energy Transfer (FRET) can detect protein interactions in living cells

    • Super-resolution microscopy techniques can visualize protein complexes at near-molecular resolution

  • Proteomics-based methods:

    • Quantitative proteomics comparing wild-type and yfbV-knockout strains

    • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) for differential protein expression analysis

For membrane proteins like YfbV, special considerations include using appropriate detergents to maintain protein solubility without disrupting interactions and potentially employing membrane mimetics (nanodiscs, liposomes) for in vitro interaction studies.

How can researchers design knockout or knockdown studies to investigate YfbV function in Shigella?

Designing effective knockout or knockdown studies for YfbV requires careful methodological planning:

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting the yfbV gene sequence

    • Include appropriate controls (wild-type and complemented strains)

    • Verify knockout through sequencing and protein expression analysis

    • Consider potential polar effects on downstream genes in the same operon

  • Homologous recombination-based knockout:

    • Replace the yfbV gene with an antibiotic resistance cassette

    • Flank the resistance marker with FRT sites for optional marker removal

    • Construct complementation plasmids expressing yfbV under native or inducible promoters

    • Create point mutations in functional domains to assess specific protein regions

  • Antisense RNA or CRISPR interference approaches:

    • For knockdown rather than complete knockout

    • Useful when knockout may be lethal

    • Allows titration of expression levels

    • Design constructs targeting different regions of the yfbV mRNA

  • Phenotypic characterization:

    • Comprehensive assessment including:

      • Growth curves under various conditions

      • Stress response assays

      • Cell invasion assays using epithelial cell lines

      • Competition assays with host microbiota

      • Mucus penetration assays

      • Animal infection models

  • Transcriptomic and proteomic analysis:

    • RNA-seq to identify genes affected by yfbV knockout

    • Proteomics to identify changes in protein expression and modification

    • Focus on virulence-associated pathways

When designing these experiments, it's crucial to account for potential redundancy in function with other membrane proteins and to consider the specific characteristics of different Shigella species, as virulence mechanisms vary between S. flexneri, S. sonnei, S. dysenteriae, and S. boydii .

What are the best experimental models for studying YfbV's role in Shigella pathogenesis?

Multiple experimental models can be employed to study YfbV's role in Shigella pathogenesis, each with specific advantages:

  • In vitro cellular models:

    • Human intestinal epithelial cell lines (Caco-2, HT-29, T84)

    • Advantage: Allow detailed molecular studies of host-pathogen interactions

    • Applications: Cell invasion assays, intracellular replication, cytotoxicity

    • Limitation: Lack the complexity of the intestinal environment

  • Ex vivo tissue models:

    • Human intestinal organoids derived from stem cells

    • Advantage: Recreate 3D architecture of intestinal epithelium with multiple cell types

    • Applications: More physiologically relevant than cell lines for studying tissue invasion

    • Key assessment: Compare invasion efficiency between wild-type and yfbV mutants

  • Microbiome interaction models:

    • In vitro gut microbiome cultures

    • Advantage: Assess how YfbV affects Shigella competition with commensal bacteria

    • Application: Particularly relevant as Shigella must compete with microbiota during infection

  • Animal models:

    • Guinea pig colorectal infection model (gold standard)

    • Mouse models with humanized intestinal flora

    • Advantage: Allow assessment of full pathogenesis cycle

    • Applications: Colonization efficiency, tissue damage, immune response

    • Measurements: Bacterial load, histopathology, cytokine profiles

  • Transcription factor binding studies:

    • ChIP-chip methodology as described in source

    • Advantage: Can identify if YfbV interacts with or is regulated by transcription factors

    • Application: Understanding regulatory networks involving YfbV

Selection of appropriate models should consider that Shigella virulence mechanisms have been primarily characterized using S. flexneri as a model organism, while other Shigella groups may employ different strategies . Comparative studies across multiple Shigella species would provide more comprehensive insights into YfbV function across the genus.

How can researchers effectively analyze the impact of YfbV on antimicrobial resistance in Shigella species?

Analyzing YfbV's potential role in antimicrobial resistance requires a multi-faceted approach:

  • Comparative genomics and transcriptomics:

    • Compare yfbV sequences and expression levels between antibiotic-resistant and sensitive strains

    • Analyze if yfbV expression changes in response to antibiotic exposure

    • Investigate potential co-localization with known resistance genes

    • Examine if YfbV is differentially expressed in pandemic strains showing increased resistance

  • Knockout/overexpression studies:

    • Generate yfbV knockout strains and test antibiotic susceptibility profiles

    • Create YfbV overexpression strains to assess if elevated levels alter resistance

    • Measure Minimum Inhibitory Concentrations (MICs) for various antibiotics

    • Assess if YfbV affects the acquisition of resistance plasmids, particularly relevant for S. sonnei which can acquire resistance genes from E. coli

  • Membrane permeability assays:

    • Determine if YfbV affects membrane integrity or permeability

    • Measure uptake of fluorescent dyes or labeled antibiotics

    • Assess efflux pump activity in wild-type versus yfbV mutants

  • Resistance transfer experiments:

    • Investigate if YfbV influences conjugation efficiency

    • Particularly relevant for S. sonnei which can share resistance plasmids through conjugation with commensal E. coli

    • Measure transfer rates of resistance plasmids in the presence/absence of YfbV

  • Clinical isolate analysis:

    • Compare YfbV sequence variations across clinical isolates with different resistance profiles

    • Focus on both pandemic strains (like globally spreading resistant S. sonnei) and local resistant S. flexneri strains

    • Correlate potential YfbV variants with resistance patterns

This research is particularly important given the concerning trends in Shigella antibiotic resistance. Recent studies have shown that S. sonnei has spread pandemically from a single European clone, acquiring multiple antibiotic resistances along the way, while S. flexneri tends to acquire resistance locally rather than through pandemic spread .

What techniques can be used to study the three-dimensional structure of YfbV and its membrane interactions?

Several advanced techniques can elucidate the three-dimensional structure of YfbV and its membrane interactions:

  • X-ray crystallography:

    • Requires purification of YfbV to homogeneity and crystallization

    • Challenges: Membrane proteins are difficult to crystallize

    • Modifications that may help: Use of fusion partners, antibody fragments, or crystallization in lipidic cubic phases

    • Resolution: Can achieve atomic-level resolution (1-3Å)

  • Cryo-electron microscopy (Cryo-EM):

    • Increasingly powerful for membrane protein structure determination

    • Advantage: No crystallization required

    • Method: Protein is embedded in vitrified ice and imaged

    • Resolution: Modern techniques can achieve near-atomic resolution (2-4Å)

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Suitable for smaller membrane proteins or domains

    • Can provide dynamic information about protein movements

    • Requires isotope labeling (15N, 13C) during protein expression

    • Particularly useful for studying protein-ligand interactions

  • Molecular dynamics simulations:

    • Computational approach to model protein behavior in membranes

    • Input requirements: Initial structural data and membrane composition parameters

    • Can provide insights into conformational changes and lipid interactions

    • Most valuable when combined with experimental structural data

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Identifies solvent-exposed regions and conformational changes

    • Particularly useful for mapping membrane-embedded portions

    • Provides information about protein dynamics and flexibility

  • Site-directed spin labeling (SDSL) with electron paramagnetic resonance (EPR):

    • Introduces spin labels at specific residues

    • Can map membrane topology and measure distances between protein segments

    • Useful for detecting conformational changes upon activation

For optimal results, researchers should consider the full-length YfbV protein (1-151 amino acids) and use complementary techniques to overcome the limitations of individual methods. The primary amino acid sequence known for S. flexneri YfbV provides a starting point for structural studies, and homology modeling may be useful if crystal structures of related proteins are available.

How should researchers interpret contradictory findings regarding YfbV function across different Shigella species?

When faced with contradictory findings regarding YfbV function across different Shigella species, researchers should employ these analytical approaches:

  • Species-specific context evaluation:

    • Consider that Shigella comprises distinct groups (S. flexneri, S. sonnei, S. dysenteriae, and S. boydii) that may employ different virulence strategies

    • Recognize that most virulence mechanism studies have used S. flexneri as a model, potentially missing important species-specific variations

    • Analyze whether contradictions correlate with specific Shigella groups or serotypes

  • Methodological differences assessment:

    • Evaluate differences in experimental conditions (growth media, oxygen levels, pH, temperature)

    • Compare protein expression systems (E. coli vs. yeast vs. mammalian cells)

    • Analyze differences in purification methods and whether native conformation was maintained

  • Genetic background consideration:

    • Examine if contradictions relate to strain-specific genetic factors

    • Consider potential compensatory mechanisms in different genetic backgrounds

    • Assess if differences in mobile genetic elements (plasmids, pathogenicity islands) may explain functional variations

  • Systematic comparative studies:

    • Design experiments that directly compare YfbV from different Shigella species under identical conditions

    • Use isogenic backgrounds when possible to minimize confounding variables

    • Employ high-throughput screening methods to compare multiple strains simultaneously

  • Evolutionary analysis:

    • Perform phylogenetic analysis of yfbV sequences across Shigella species

    • Correlate sequence variations with functional differences

    • Consider selective pressures that might drive divergent functions

  • Meta-analysis approach:

    • Compile and statistically analyze results from multiple studies

    • Weight findings based on methodological rigor and sample size

    • Identify patterns that might explain apparent contradictions

Researchers should remember that apparent contradictions may actually reflect genuine biological diversity in YfbV function across Shigella species, particularly given the evidence for diverse virulence mechanisms among Shigella groups .

What bioinformatic tools and databases are most useful for analyzing YfbV protein sequence, structure, and function?

Researchers studying YfbV can leverage numerous bioinformatic tools and databases:

  • Sequence analysis tools:

    • BLAST/PSI-BLAST: Identify homologs across bacterial species

    • Clustal Omega/MUSCLE: Multiple sequence alignment to identify conserved regions

    • HMMER: For sensitive detection of remote homologs using profile hidden Markov models

    • SignalP/TMHMM: Predict signal peptides and transmembrane domains critical for membrane proteins

  • Structural prediction tools:

    • AlphaFold2/RoseTTAFold: State-of-the-art protein structure prediction using deep learning

    • I-TASSER: Integrated platform for protein structure and function prediction

    • SWISS-MODEL: Automated protein homology-modeling

    • PPM server: Specifically for positioning proteins in membranes

  • Functional annotation databases:

    • UniProt: Comprehensive resource for protein sequence and annotation data (UniProt ID for S. flexneri YfbV: Q0T2J2)

    • Pfam: Database of protein families and domains

    • STRING: Database of known and predicted protein-protein interactions

    • KEGG: For pathway mapping and functional analysis

  • Specialized membrane protein resources:

    • MemProtMD: Database of membrane protein simulations

    • OPM (Orientations of Proteins in Membranes): Database of membrane protein orientations

    • TOPDB: Topology database of transmembrane proteins

  • Comparative genomics platforms:

    • Pathosystems Resource Integration Center (PATRIC): Bacterial bioinformatics resource center

    • Integrated Microbial Genomes (IMG): For genome analysis and annotation

    • SeroTypeFinder: For Shigella serotype identification

  • Evolutionary analysis tools:

    • MEGA X: Molecular Evolutionary Genetics Analysis

    • RAxML/IQ-TREE: Maximum likelihood phylogenetic analysis

    • FigTree: For visualization of phylogenetic trees

When analyzing YfbV specifically, researchers should start with the known amino acid sequence from S. flexneri (151 amino acids) , identify conserved domains, predict membrane topology, and compare with homologs across different Shigella species and related Enterobacteriaceae to gain insights into potential functions.

How is the changing epidemiology of Shigella species affecting research priorities for proteins like YfbV?

The changing epidemiology of Shigella species has significant implications for YfbV research priorities:

  • Shifts in predominant species:

    • Recent epidemiological data show S. sonnei replacing S. flexneri in regions with improved water sanitation

    • This shift necessitates increased focus on S. sonnei YfbV characterization rather than the traditionally studied S. flexneri YfbV

    • Comparative studies of YfbV across different Shigella species become increasingly important

  • Antibiotic resistance considerations:

    • S. sonnei is rapidly acquiring antibiotic resistance genes through horizontal transfer from E. coli

    • Research should investigate if YfbV plays any role in adaptation to antibiotic pressure

    • Priority should be given to understanding if YfbV affects membrane permeability or antibiotic efflux

  • Geographical distribution impact:

    • Different Shigella species show distinct geographical distribution patterns

    • S. flexneri resistance tends to be acquired locally, while resistant S. sonnei strains spread pandemically

    • YfbV research should consider these distinct epidemiological patterns when designing studies

  • Vaccine development implications:

    • Current vaccine development efforts target S. sonnei and remaining S. flexneri serotypes (2a, 3a, and 6)

    • Research priorities include determining if YfbV could serve as a cross-protective antigen

    • Studies should evaluate YfbV conservation across targeted serotypes

  • High-throughput comparative approaches:

    • Modern technologies enable systematic comparison of protein function across species

    • Research should leverage these approaches to understand YfbV variability across Shigella species

    • Integration of genomic, transcriptomic, and proteomic data will provide comprehensive insights

The Global Enteric Multicenter Study (GEMS) demonstrated that Shigella remains a leading cause of childhood morbidity and mortality in sub-Saharan Africa and Asia . This underscores the continued importance of understanding virulence factors like YfbV, particularly as species distribution shifts and antibiotic resistance increases.

What are the potential applications of YfbV research in vaccine development or therapeutic interventions?

YfbV research could contribute to Shigella vaccine development and therapeutic interventions in several ways:

  • Cross-species antigen potential:

    • If YfbV proves to be highly conserved across Shigella species, it could potentially serve as a cross-protective antigen

    • This would address a major challenge in Shigella vaccine development: the serotype-specificity of immune protection

    • Research should focus on mapping conserved epitopes that could elicit cross-protective antibodies

  • Recombinant protein vaccine component:

    • Recombinant YfbV protein, similar to the His-tagged versions currently available for research , could be evaluated as a component in subunit vaccines

    • Expression systems already established for research purposes could be adapted for vaccine production

    • Proper folding and stability would be critical considerations

  • Attenuated live vaccine development:

    • Understanding YfbV's role in virulence could inform rational attenuation strategies

    • If YfbV contributes to pathogenicity without being essential for growth, yfbV mutants could be candidate strains for live attenuated vaccines

    • This approach would need to address the colonization discrepancies observed between Western volunteers and individuals in endemic areas

  • Drug target exploration:

    • If YfbV proves essential for Shigella pathogenicity or antimicrobial resistance, it could represent a novel drug target

    • Small molecule inhibitors targeting YfbV function could be developed

    • Structural studies of YfbV would facilitate structure-based drug design

  • Diagnostic applications:

    • YfbV-specific antibodies could be developed for Shigella detection in clinical or environmental samples

    • If species-specific variations exist, they could potentially be leveraged for serotype differentiation

  • Understanding colonization mechanisms:

    • YfbV research may shed light on factors affecting Shigella colonization

    • This could help address the "clear discrepancy in the colonization and potential protective capacity" of vaccine candidates between populations

Researchers should consider that vaccine development against Shigella requires addressing multiple serotypes, as protection is typically serotype-specific. A multivalent approach targeting epidemiologically relevant serotypes (S. sonnei and S. flexneri serotypes 2a, 3a, and 6) would be necessary .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.