Recombinant Shigella boydii serotype 4 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
yciC; SBO_1810; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSELIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGIFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links

KEGG: sbo:SBO_1810

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How can researchers optimize structural determination of yciC protein?

For structural characterization of yciC, researchers should consider:

  • Employing recent advances in membrane protein solubilization using Water-soluble RFdiffused Amphipathic Proteins (WRAPs), which have been shown to preserve membrane protein structure while enhancing stability and solubility .

  • Utilizing cryo-electron microscopy (cryo-EM) for structural determination, which can achieve resolutions around 4.0 Å for membrane proteins as demonstrated with other bacterial outer membrane proteins .

  • Comparing computational prediction methods with experimental data through techniques such as:

    • Circular dichroism spectroscopy for secondary structure estimation

    • Limited proteolysis to identify domain boundaries

    • Cross-linking mass spectrometry to validate predicted structural features

How do hydrophobic regions in yciC affect experimental approaches?

The multiple hydrophobic regions in yciC create specific experimental challenges that must be addressed:

  • During expression, these regions can cause protein aggregation, requiring:

    • Lower induction temperatures (16-20°C)

    • Specialized expression hosts (C41/C43 E. coli strains)

    • Co-expression with chaperones to facilitate proper folding

  • For purification and handling:

    • Carefully selected detergents (DDM, LMNG, or digitonin) must be used to maintain native structure

    • Consider detergent-free approaches such as WRAP technology to preserve structural integrity

    • Optimize buffer conditions with stabilizing agents like glycerol

What are optimal expression systems for producing functional recombinant yciC protein?

Expression of membrane proteins like yciC requires specialized approaches:

For optimal functional protein, consider using fusion tags (MBP, SUMO) to enhance solubility and proper folding during expression .

What purification strategy yields highest purity and activity for yciC?

A systematic purification approach includes:

  • Initial extraction:

    • Screen multiple detergents (DDM, LMNG, OG, digitonin) at different concentrations

    • Optimize detergent-to-protein ratio to prevent aggregation

    • Consider the novel WRAP technology that uses designed proteins to solubilize membrane proteins while preserving structure and function

  • Multi-step purification:

    • Immobilized metal affinity chromatography (IMAC) utilizing a His-tag

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

    • Ion exchange chromatography for final polishing

  • Quality assessment:

    • SDS-PAGE with Coomassie staining to assess purity (>95%)

    • Western blot to confirm identity

    • Dynamic light scattering to confirm homogeneity and lack of aggregation

How can researchers overcome stability challenges with purified yciC protein?

Stability optimization for membrane proteins like yciC requires:

  • Buffer optimization through systematic screening:

    • pH range (6.0-8.0)

    • Salt concentration (100-500 mM)

    • Stabilizing additives (glycerol 5-20%, arginine 50-200 mM)

  • Alternative solubilization approaches:

    • Nanodiscs or SMALPs to provide a lipid environment

    • Amphipols for enhanced stability

    • The WRAP technology described for solubilizing membrane proteins without detergents

  • Storage condition optimization:

    • Flash freezing in liquid nitrogen with cryoprotectants

    • Short-term storage at 4°C with preservatives

    • Lyophilization protocols with appropriate excipients

What are the hypothesized functions of yciC in S. boydii pathogenesis?

While specific functions of yciC remain uncharacterized, methodological approaches to investigate its role include:

  • Gene knockout studies:

    • CRISPR/Cas9-mediated deletion

    • Phenotypic analysis of ΔyciC mutants in infection models

    • Complementation studies to confirm phenotype specificity

  • Interaction studies:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation with potential partners

    • Cross-linking followed by mass spectrometry

  • Comparative analysis:

    • Sequence comparison with functionally characterized homologs

    • Evaluation in context of S. boydii pathogenesis mechanisms

    • Assessment of expression patterns during infection

The membrane localization suggests potential roles in nutrient transport, signaling, or host-pathogen interactions that could be relevant to S. boydii virulence mechanisms.

How does yciC compare with membrane proteins from other Shigella serotypes?

Methodological approach for comparative analysis:

  • Sequence and structural comparison:

    • Multiple sequence alignment of yciC homologs across Shigella serotypes

    • Identification of conserved versus variable regions

    • Construction of phylogenetic trees to understand evolutionary relationships

  • Functional comparison:

    • Cross-complementation studies between serotypes

    • Expression profiling under identical conditions

    • Host interaction studies to identify serotype-specific differences

  • Immunological cross-reactivity:

    • Antibody cross-reactivity testing

    • Epitope mapping to identify serotype-specific regions

    • T-cell response profiling

This comparative approach may reveal insights into serotype-specific immune responses, similar to those observed between S. flexneri 2a and S. sonnei, where distinct innate and adaptive immune profiles were documented .

How can researchers distinguish between species-specific and conserved functions of yciC?

To differentiate between specific and conserved functions:

  • Systematic mutagenesis approach:

    • Alanine scanning of conserved residues

    • Domain swapping between homologs from different species

    • Creation of chimeric proteins to map functional domains

  • Cross-species complementation:

    • Express S. boydii yciC in other Shigella species or E. coli

    • Assess phenotypic rescue of knockout mutants

    • Compare function across evolutionary distance

  • Comparative genomics:

    • Synteny analysis to examine conservation of genomic context

    • Selection pressure analysis (dN/dS ratios) to identify regions under positive selection

    • Correlation with known serotype-specific virulence mechanisms

How can yciC be utilized in studying host immune responses to S. boydii infection?

Methodological approaches include:

  • Epitope mapping:

    • Overlapping peptide arrays to identify immunodominant regions

    • ELISA-based assays using recombinant yciC protein

    • T-cell stimulation assays with synthetic peptides

  • Serological studies:

    • Development of serotype-specific assays using purified yciC

    • Analysis of anti-yciC antibodies in patient sera

    • Comparison with immune responses to other Shigella antigens

  • Cross-reactivity analysis:

    • Testing antibody recognition across different Shigella serotypes

    • Correlation with protective immunity

    • Identification of serotype-specific versus conserved epitopes

These approaches can build upon the observation that different Shigella serotypes induce distinct innate and adaptive immune profiles, as demonstrated in controlled human infection models .

What is the potential of yciC as a diagnostic marker for S. boydii serotype 4 infections?

For diagnostic development using yciC:

  • Antibody-based methods:

    • ELISA using recombinant yciC protein

    • Lateral flow assays for point-of-care testing

    • Bead-based multiplex assays for serotype differentiation

  • Molecular detection:

    • PCR primer design targeting unique regions of the yciC gene

    • Loop-mediated isothermal amplification (LAMP) for field settings

    • Next-generation sequencing for comprehensive typing

  • Validation approach:

    • Testing against clinical isolate panels

    • Determining sensitivity and specificity

    • Cross-reactivity evaluation with other enteric pathogens

The phage-based approach developed for S. boydii type 1 provides a model for serotype-specific diagnostic development that could be adapted for serotype 4 using yciC-targeting methods .

Can yciC contribute to vaccine development against S. boydii?

Exploring yciC as a vaccine component requires:

  • Immunogenicity assessment:

    • Animal immunization studies with purified yciC

    • Evaluation of antibody titers and specificity

    • T-cell response characterization

  • Protection studies:

    • Challenge experiments in appropriate animal models

    • Passive immunization with anti-yciC antibodies

    • Cross-protection assessment against multiple serotypes

  • Antigen optimization:

    • Identification of protective epitopes

    • Construction of multivalent antigens

    • Suitable adjuvant selection

The WRAP solubilization technology could be particularly valuable here, as it has been used to solubilize outer membrane protein antigens while preserving their immunogenic properties, as demonstrated with Treponema pallidum antigens .

How can novel solubilization methods improve research on yciC?

Recent advances in membrane protein solubilization offer new research opportunities:

  • The WRAP (Water-soluble RFdiffused Amphipathic Proteins) technology:

    • Uses designed proteins to surround hydrophobic surfaces of membrane proteins

    • Renders them stable and water-soluble without detergents

    • Preserves native structure and function

  • Application methodology:

    • Design WRAPs specifically for yciC using deep learning approaches

    • Express and purify the solubilized complex

    • Verify structure and function using biochemical assays

    • Apply to structural studies and immunological research

  • Advantages over traditional methods:

    • Enhanced stability in aqueous solutions

    • Preservation of native conformation

    • Improved yield from expression systems

    • Compatible with multiple downstream applications

What high-throughput approaches can accelerate functional characterization of yciC?

Systematic high-throughput methodologies include:

  • Interaction screening:

    • Protein microarrays with host proteins

    • Split reporter assays for protein-protein interactions

    • Mass spectrometry-based interactome analysis

  • Functional genomics:

    • Transposon sequencing (Tn-Seq) to identify genetic interactions

    • CRISPR interference screening for pathway mapping

    • RNA-Seq under various conditions to identify co-regulated genes

  • Small molecule screening:

    • Compound libraries to identify inhibitors or activators

    • Activity-based protein profiling

    • Fragment-based drug discovery approaches

  • Data integration:

    • Machine learning to predict function from sequence and structure

    • Network analysis to place yciC in cellular pathways

    • Systems biology approaches to understand context-dependent functions

How can heterologous expression systems be optimized for challenging membrane proteins like yciC?

Optimization strategies include:

ParameterExperimental ApproachExpected OutcomeMeasurement Method
Codon optimizationDesign synonymous gene with host-optimized codonsImproved translation efficiencyIncreased protein yield by Western blot
Expression temperatureTest range from 16-37°CBalance between folding and expression rateActivity assays and aggregation assessment
Induction conditionsVary inducer concentration and timingOptimize expression while minimizing toxicityGrowth curves and protein yield analysis
Fusion partnersTest MBP, SUMO, Trx, GST fusionsEnhanced solubility and foldingSolubility comparison by fractionation
Host strain selectionCompare specialized strains (C41/C43, BL21, Rosetta)Match host to protein requirementsExpression level and proper folding assessment
Media compositionTest minimal vs. rich media, supplementsAddress metabolic burdenGrowth rate and protein quality analysis

How has yciC evolved across different Shigella serotypes?

Evolutionary analysis methodology:

  • Phylogenetic reconstruction:

    • Multiple sequence alignment of yciC homologs

    • Maximum likelihood tree construction

    • Reconciliation with species phylogeny

    • Comparison with serotype distribution patterns observed in epidemiological studies

  • Selection pressure analysis:

    • Calculate dN/dS ratios across alignment

    • Identify sites under positive or purifying selection

    • Map selected sites to predicted structural features

    • Correlate with functional domains

  • Recombination analysis:

    • Detect potential horizontal gene transfer events

    • Identify mosaic structures within the gene

    • Relate to known serotype diversification patterns, similar to the processes that led to the establishment of new S. boydii serotypes (16, 17, and 18)

How does genomic context of yciC compare across Shigella species and other enteric bacteria?

Comparative genomic methodology:

  • Synteny analysis:

    • Compare gene neighborhoods across species

    • Identify conserved gene clusters

    • Detect genomic rearrangements

  • Operon structure investigation:

    • Transcriptomic data analysis to confirm co-transcription

    • Promoter analysis for regulatory elements

    • Terminator identification

  • Mobile genetic element association:

    • Screen for nearby insertion sequences

    • Identify prophage remnants

    • Assess association with genomic islands

  • Integration with functional data:

    • Connect genomic context with expression patterns

    • Relate to co-regulation networks

    • Identify potential functional partners

What bioinformatic approaches can predict functional domains in uncharacterized proteins like yciC?

Computational prediction methodology:

  • Sequence-based prediction:

    • Profile hidden Markov models for domain detection

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Signal peptide prediction (SignalP)

    • Functional motif identification (PROSITE)

  • Structure-based approaches:

    • Homology modeling using related structures

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations in membrane environment

    • Binding site prediction

  • Evolutionary approaches:

    • Evolutionary trace analysis to identify functional residues

    • Correlated mutation analysis for structural contacts

    • Conservation mapping to identify functional surfaces

  • Integration of multiple predictions:

    • Consensus approaches from different algorithms

    • Machine learning methods combining multiple features

    • Bayesian integration of diverse evidence types

How can single-molecule techniques advance understanding of yciC function?

Single-molecule methodological approaches:

  • Single-molecule FRET (smFRET):

    • Strategic placement of fluorophore pairs on yciC

    • Real-time monitoring of conformational changes

    • Correlation with substrate binding or environmental changes

    • Detection of rare or transient conformational states

  • Atomic force microscopy (AFM):

    • Direct visualization of yciC in membrane environment

    • Force spectroscopy to probe mechanical properties

    • Mapping interaction landscapes with binding partners

    • Time-lapse imaging to capture dynamic processes

  • Single-molecule tracking in live cells:

    • Fluorescent protein fusions with yciC

    • Super-resolution microscopy (PALM/STORM)

    • Diffusion coefficient measurement in different conditions

    • Colocalization with other bacterial components

What is the current state of research on membrane protein solubilization technologies applicable to yciC?

Recent advances in solubilization methods:

  • Deep learning-based design of WRAP proteins:

    • Creates water-soluble versions of membrane proteins

    • Preserves native structure and function

    • Enables structural studies without detergents

    • Has been successfully applied to both beta-barrel and helical membrane proteins

  • Demonstration with various membrane protein types:

    • Beta-barrel outer membrane proteins

    • Multi-pass transmembrane helical proteins

    • Retention of binding and enzymatic functions

    • Enhanced stability in water-soluble form

  • Application to structural biology:

    • Achievement of 4.0 Å cryo-EM resolution for solubilized proteins

    • Preservation of native folding and epitopes

    • Potential for crystallization without detergent interference

How does yciC research contribute to understanding serotype-specific immunity in Shigella infections?

Integrating yciC research with immunological studies:

  • Serotype-specific immune profiling:

    • Comparison of immune responses to different serotypes

    • Identification of serotype-specific versus conserved epitopes

    • Correlation with protective immunity

    • Building on observations of distinct immune profiles induced by different Shigella serotypes

  • Cross-protection assessment:

    • Evaluation of antibodies against yciC for cross-serotype neutralization

    • T-cell epitope conservation analysis

    • Challenge studies in appropriate models

    • Connection to serotype-specific protection observed in human challenge models

  • Implications for vaccine development:

    • Potential inclusion of yciC in multi-valent vaccines

    • Targeting of conserved epitopes for broad protection

    • Design of chimeric antigens incorporating protective epitopes

    • Consideration of serotype distribution in target populations, such as the prevalence data for S. boydii serotypes in Bangladesh

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.