Recombinant Shigella boydii serotype 4 UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant yobD is synthesized in E. coli via bacterial expression systems. Key steps include:

ProcessDetailsSource
Expression HostE. coli ,
PurificationAffinity chromatography (His-tag), followed by SDS-PAGE validation ,
FormLyophilized powder or liquid (concentration: 0.1–1.0 mg/mL) ,
Stability6 months at -20°C/-80°C (liquid); 12 months at -20°C/-80°C (lyophilized)

Commercial suppliers emphasize avoiding repeated freeze-thaw cycles to preserve activity .

Potential Functional Roles

While direct research on yobD is limited, its classification as a membrane protein suggests roles in:

  • Membrane Integrity: Stabilizing or modifying bacterial outer membrane structure.

  • Host Interaction: Facilitating adhesion or invasion, similar to other Shigella membrane proteins (e.g., OmpA, IpaB) .

  • Immune Evasion: Modulating host immune responses, as seen with Shigella outer membrane vesicles (OMVs) .

Research Applications

ApplicationDetailsRelevance
Vaccine DevelopmentPotential antigen for multi-serotype vaccines (e.g., MOMVs) .High
Structural BiologyX-ray crystallography or cryo-EM to study membrane protein folding.Moderate
Diagnostic ToolsAntibody-based assays for detecting Shigella infections.Moderate

Challenges and Gaps

ChallengeDetailsSource
Functional ElucidationNo published studies link yobD to specific biochemical pathways.
Cross-Species ReactivityLimited data on whether antibodies against yobD cross-react with other Shigella serotypes.
Commercial AvailabilityLimited to specialized suppliers (e.g., Creative Biomart, GeneBioSystems).

Comparison with Related Proteins

ProteinSerotypeUniProt IDLengthPuritySource
yobD (serotype 4)4Q321Z71–158 aa>85%
yobD (serotype 18)18B2U4601–152 aa>90%
UPF0442 (yjjB)4Q31SX31–157 aa

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during production. If you require a specific tag, please inform us in advance, and we will prioritize its implementation.

Synonyms
yobD; SBO_1232; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRIPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSGNAANLLI
Uniprot No.

Target Background

Database Links

KEGG: sbo:SBO_1232

Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Characterization and Handling

  • What are the optimal storage and handling conditions for recombinant yobD protein preparations?

    For optimal stability and activity, recombinant Shigella boydii serotype 4 UPF0266 membrane protein yobD should be stored following these guidelines :

    • Store lyophilized protein at -20°C/-80°C (shelf life approximately 12 months)

    • For reconstituted protein, store at -20°C in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles; prepare working aliquots stored at 4°C for up to one week

    • When reconstituting, briefly centrifuge the vial before opening and use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50%

    Membrane proteins are typically sensitive to denaturation; therefore, maintaining proper buffer conditions is essential for preserving the native conformation and functionality.

  • How do you verify the purity and integrity of recombinant yobD protein after purification?

    To verify purity and integrity of recombinant yobD protein:

    1. SDS-PAGE analysis: Run the protein on SDS-PAGE to confirm >90% purity and correct molecular weight (approximately 18 kDa plus any tag contributions)

    2. Western blotting: Use anti-His antibodies (if His-tagged) to confirm identity

    3. Mass spectrometry: For precise mass confirmation and potential post-translational modifications

    4. Circular dichroism (CD) spectroscopy: To verify proper secondary structure folding

    5. Dynamic light scattering (DLS): To check for protein aggregation

    The recombinant protein should appear as a distinct band at the expected molecular weight, with minimal contaminants. For membrane proteins, proper refolding is particularly critical and may be assessed using biophysical methods that evaluate secondary structure.

Experimental Applications and Protocols

  • What are the recommended protocols for expressing recombinant Shigella boydii serotype 4 yobD protein in E. coli?

    For optimal expression of recombinant Shigella boydii serotype 4 yobD in E. coli:

    1. Vector selection: Use pET expression systems with N-terminal His-tag for easier purification

    2. E. coli strain: BL21(DE3) or Rosetta strains are preferred for membrane protein expression

    3. Growth conditions:

      • Grow cultures at 37°C until OD600 reaches 0.6-0.8

      • Induce with 0.1-0.5 mM IPTG

      • Shift to lower temperature (16-25°C) post-induction

      • Continue expression for 16-18 hours

    4. Extraction method: Similar to methods described for other Shigella membrane proteins :

      • Resuspend bacterial pellet in PBS (pH 7.4)

      • Add n-octyl-β-D-glucopyranoside to 0.5% final concentration

      • Homogenize using vortex

      • Centrifuge at 12,000 rpm at 4°C for 15 minutes

      • Repeat extraction three times

    5. Purification: Use immobilized metal affinity chromatography (IMAC) followed by anion-exchange chromatography to remove contaminants

    Membrane proteins like yobD often require optimization of expression conditions to balance yield with proper folding.

  • How can I assess if recombinant yobD protein retains its native conformation after purification?

    To assess native conformation of purified recombinant yobD:

    1. Circular dichroism (CD) spectroscopy: Compare the CD spectrum with predicted secondary structure based on amino acid sequence

    2. Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate proper folding

    3. Limited proteolysis: Properly folded proteins show resistance to proteolysis at specific sites

    4. Functional assays: Based on similar membrane proteins, assess:

      • Membrane association using liposome binding assays

      • Hemagglutination activity (if applicable, as seen with other Shigella membrane proteins)

    5. Size exclusion chromatography: To verify monomeric state or expected oligomerization

    The conformation assessment is particularly important for membrane proteins as their structure is highly dependent on the surrounding environment. Comparisons with other characterized Shigella membrane proteins can provide reference data.

  • What approaches can be used to study the immunogenicity of recombinant yobD protein?

    To study immunogenicity of recombinant yobD protein:

    1. Animal immunization models:

      • Prime-boost-boost immunization protocols in BALB/c mice (similar to protocols used for Shigella OMVs)

      • Intranasal immunization with appropriate adjuvants (e.g., dmLT)

    2. Antibody response measurement:

      • ELISA for serum IgG and mucosal IgA titers

      • Western blot analysis for epitope recognition

      • Flow cytometry to assess binding to intact bacteria

    3. T-cell response evaluation:

      • ELISpot for IFN-γ, IL-4, and IL-17 production

      • T-cell proliferation assays with purified protein

    4. Cross-reactivity assessment:

      • Western blotting against OMPs from different Shigella species

      • Checkerboard tests using dot blot methods with serial dilutions

    5. Protection studies:

      • Lethal pulmonary infection model

      • Intraperitoneal challenge model

    Previous studies with Shigella membrane proteins have shown that antibodies against one species' membrane proteins can cross-react with other Shigella species, which may be relevant for yobD as well .

Advanced Research Applications

  • How could recombinant yobD be incorporated into a multiepitope fusion antigen (MEFA) approach for Shigella vaccine development?

    Incorporating yobD into a MEFA approach for Shigella vaccine development:

    1. Epitope identification and selection:

      • Perform computational epitope prediction on yobD sequence

      • Validate predicted B-cell and T-cell epitopes experimentally

      • Select epitopes conserved across Shigella species

    2. MEFA design strategy:

      • Use a scaffold protein (similar to approaches with IpaB, IpaD, VirG)

      • Insert selected yobD epitopes at surface-exposed regions

      • Combine with established protective epitopes from:

        • IpaB and IpaD (type III secretion proteins)

        • VirG (bacterial surface protein)

        • Conserved regions of other membrane proteins

    3. Expression and purification optimization:

      • Test multiple expression systems

      • Optimize purification to maintain epitope conformation

      • Validate structural integrity using biophysical methods

    4. Immunogenicity assessment:

      • Evaluate antibody responses to individual epitopes

      • Assess T-cell responses to incorporated epitopes

      • Compare with responses to individual proteins

    5. Protection studies:

      • Challenge with multiple Shigella species and serotypes

      • Evaluate protection breadth compared to single-antigen approaches

    This approach would build on successful MEFA strategies that have shown promise for broad protection against heterogeneous Shigella species and serotypes .

  • What methodological approaches would be most effective for studying potential interactions between yobD and the host immune system?

    To study yobD interactions with the host immune system:

    1. Innate immune recognition studies:

      • Screen interactions with pattern recognition receptors (TLRs, NODs)

      • Assess activation of macrophages and dendritic cells

      • Measure cytokine/chemokine production profiles

      • Evaluate inflammasome activation (similar to what's known for IpaB)

    2. Adaptive immune response characterization:

      • Map B-cell epitopes using epitope mapping techniques

      • Identify MHC-I and MHC-II restricted T-cell epitopes

      • Characterize antibody isotype and subclass distributions

      • Assess memory B and T cell responses after immunization

    3. Mucosal immunity focus:

      • Evaluate induction of secretory IgA in intestinal mucosa

      • Measure tissue-resident memory T cells in intestinal tissues

      • Assess protection against bacterial colonization in mucosal surfaces

    4. Systems immunology approach:

      • Transcriptomics of immune cells exposed to yobD

      • Proteomics to identify interacting immune proteins

      • Network analysis to understand immunomodulatory effects

    5. In vivo studies:

      • Use transgenic mouse models to elucidate specific immune pathways

      • Employ adoptive transfer experiments to identify protective immune components

    These approaches would provide comprehensive understanding of how yobD interacts with host immunity, informing rational vaccine design strategies.

  • How can structural biology techniques be applied to elucidate the tertiary structure and membrane topology of yobD?

    Structural biology approaches for yobD characterization:

    1. X-ray crystallography:

      • Express protein with fusion partners to enhance solubility

      • Use lipidic cubic phase crystallization for membrane proteins

      • Obtain diffraction data to resolve atomic structure

    2. Cryo-electron microscopy (cryo-EM):

      • Reconstitute protein in nanodiscs or detergent micelles

      • Collect high-resolution images of protein particles

      • Perform single-particle analysis for structure determination

    3. NMR spectroscopy:

      • Isotope label the protein (15N, 13C)

      • Collect multidimensional NMR data

      • Determine structure in membrane-mimetic environments

    4. Membrane topology mapping:

      • Cysteine scanning mutagenesis with accessibility reagents

      • Protease protection assays

      • Fluorescence quenching experiments

    5. Computational structure prediction:

      • Apply AlphaFold2 or RoseTTAFold algorithms

      • Validate predictions with experimental data

      • Use molecular dynamics simulations to study dynamics in membranes

    6. Hydrogen-deuterium exchange mass spectrometry:

      • Identify solvent-accessible regions

      • Determine protein dynamics and flexibility

      • Map potential interaction interfaces

    Understanding the structural properties of yobD would provide critical insights into its function and potential role in Shigella pathogenesis or immunity.

  • What methodological challenges exist in evaluating potential interactions between yobD and other bacterial membrane components?

    Methodological challenges in studying yobD interactions with other membrane components:

    1. Maintaining native membrane environment:

      • Challenge: Membrane proteins lose native interactions when extracted

      • Approach: Use cross-linking prior to extraction

      • Method: Employ membrane-permeable crosslinkers followed by pull-down assays

    2. Distinguishing direct from indirect interactions:

      • Challenge: Protein complexes may contain bridging proteins

      • Approach: Use binary interaction assays

      • Method: Apply FRET, split-GFP complementation, or bacterial two-hybrid systems

    3. Reconstituting functional complexes:

      • Challenge: Ensuring proper orientation in artificial membranes

      • Approach: Develop directed reconstitution strategies

      • Method: Use liposomes with controlled protein insertion orientation

    4. Detecting transient interactions:

      • Challenge: Short-lived interactions are difficult to capture

      • Approach: Employ kinetic trapping methods

      • Method: Use photo-activatable crosslinkers with temporal control

    5. Quantifying interaction strengths in membranes:

      • Challenge: Traditional affinity measurements are solution-based

      • Approach: Develop membrane-specific quantification

      • Method: Apply microscale thermophoresis or surface plasmon resonance with nanodiscs

    6. Visualizing interactions in situ:

      • Challenge: Resolving individual proteins in bacterial membranes

      • Approach: Use super-resolution microscopy

      • Method: Apply techniques like STORM or PALM with specific labeling

    Overcoming these challenges requires interdisciplinary approaches combining advanced biophysical techniques with molecular biology methods tailored to membrane protein complexes.

  • How can transcriptomic and proteomic approaches be used to elucidate the regulation and expression patterns of yobD during Shigella infection?

    Transcriptomic and proteomic approaches for understanding yobD regulation:

    1. RNA-Seq analysis under infection-relevant conditions:

      • Compare transcription profiles across:

        • Different growth phases

        • Varied environmental conditions (pH, bile salts, oxygen)

        • Host-mimicking environments

        • During intracellular stages post-invasion

      • Identify co-regulated genes to establish functional networks

    2. Quantitative proteomics:

      • Use stable isotope labeling (SILAC or TMT)

      • Map yobD protein abundance across infection stages

      • Compare with other membrane proteins

      • Identify post-translational modifications

    3. Regulatory element identification:

      • Perform ChIP-Seq to identify transcription factor binding sites

      • Use 5' RACE to map transcription start sites

      • Apply reporter constructs to validate regulatory elements

    4. Host-pathogen interaction studies:

      • Dual RNA-Seq to capture both bacterial and host transcriptomes

      • Temporal analysis during infection progression

      • Spatially resolved transcriptomics in infected tissues

    5. Systems biology integration:

      • Correlate transcriptomic and proteomic data

      • Build regulatory networks

      • Identify key nodes controlling yobD expression

    6. Single-cell approaches:

      • Apply bacterial single-cell RNA-Seq

      • Assess heterogeneity in yobD expression

      • Correlate with bacterial subpopulations during infection

    These approaches would provide comprehensive understanding of when and where yobD is expressed during infection, offering insights into its potential functional significance in Shigella pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.