Recombinant Shigella boydii serotype 4 UPF0283 membrane protein YcjF (ycjF)

What is the molecular structure of Shigella boydii serotype 4 UPF0283 membrane protein YcjF?

Shigella boydii serotype 4 UPF0283 membrane protein YcjF is a full-length protein consisting of 353 amino acids. The protein sequence begins with MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDE and continues through a complex structure that suggests membrane association properties. The protein is encoded by the ycjF gene and has been assigned the UniProt accession number Q320A9 in strain Sb227. The protein appears to have transmembrane domains consistent with its classification as a membrane protein, which likely contributes to its structural role in the bacterial cell envelope .

What are the recommended storage conditions for maintaining protein stability?

For optimal stability, recombinant YcjF protein should be stored at -20°C, with extended storage recommended at -20°C or -80°C. The protein is typically provided in a Tris-based buffer with 50% glycerol, which helps maintain stability during freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity . For longer-term storage, aliquoting the protein into single-use volumes before freezing is advised to minimize freeze-thaw cycles .

What expression systems are most effective for producing recombinant YcjF protein?

E. coli expression systems have been successfully employed for the production of recombinant YcjF protein from Shigella species. When expressing recombinant Shigella boydii serotype 18 UPF0283 membrane protein YcjF, E. coli has been the preferred expression host, allowing for the production of the full-length protein (1-353 amino acids) . The addition of an N-terminal His-tag facilitates subsequent purification steps through affinity chromatography. When designing expression constructs, researchers should consider codon optimization for E. coli if the native Shigella sequence contains rare codons that might limit expression efficiency .

What purification strategies yield the highest purity of recombinant YcjF?

For His-tagged YcjF protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices provides an efficient initial purification step. Commercial preparations typically achieve greater than 90% purity as determined by SDS-PAGE analysis . After IMAC purification, size exclusion chromatography can be employed as a polishing step to remove any aggregates or impurities. The purified protein is often provided as a lyophilized powder, which requires proper reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for stability during storage .

How should YcjF protein be reconstituted for experimental use?

For optimal reconstitution of lyophilized YcjF protein, the vial should first be briefly centrifuged to bring all contents to the bottom. The protein should then be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage of the reconstituted protein, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard for commercial preparations . After reconstitution, the solution should be gently mixed without vigorous vortexing to avoid protein denaturation, and aliquoted for storage at -20°C/-80°C to minimize freeze-thaw cycles .

What is known about the function of YcjF in Shigella pathogenesis?

While the specific function of YcjF in Shigella pathogenesis is not fully characterized, its conservation across different Shigella species and its classification as a membrane protein suggest potential roles in membrane integrity, cell envelope biogenesis, or host-pathogen interactions. Research exploring the virulence mechanisms of Shigella boydii, which accounts for 5.4% of all Shigella infections in some regions, may benefit from further investigation of the YcjF protein's function in pathogenicity . Comparative studies between different serotypes of S. boydii, particularly between the prevalent type 1 and serotype 4, could provide insights into serotype-specific virulence factors and their relationship to the YcjF protein .

What approaches can be used to study YcjF protein-protein interactions?

To study YcjF protein-protein interactions, researchers can employ several complementary techniques. Pull-down assays using His-tagged YcjF as bait can identify potential binding partners in Shigella lysates. Cross-linking studies followed by mass spectrometry analysis can capture transient interactions within the bacterial membrane environment. Yeast two-hybrid or bacterial two-hybrid systems may also be adapted to screen for specific protein-protein interactions, though these approaches may require careful design for membrane proteins. For in vitro studies, surface plasmon resonance or isothermal titration calorimetry using purified recombinant YcjF can provide quantitative binding parameters for identified interaction partners .

How might structural biology approaches contribute to understanding YcjF function?

Structural biology approaches would significantly advance understanding of YcjF function. X-ray crystallography of purified recombinant YcjF could reveal the three-dimensional structure, providing insights into potential active sites or binding pockets. Cryo-electron microscopy might be particularly valuable for studying YcjF in its membrane context or in complex with interaction partners. NMR spectroscopy could provide information on protein dynamics and ligand binding. Computational approaches such as molecular dynamics simulations, using the amino acid sequence information available for different Shigella species, could predict structural differences between YcjF variants and their potential functional implications .

How can YcjF protein be utilized in developing diagnostic tools for Shigella infections?

The YcjF protein represents a potential target for developing serotype-specific diagnostic tools for Shigella infections. Research on phage-based diagnostics has shown promise, as demonstrated by the isolation of phage MK-13, which specifically targets S. boydii type 1 . Similar approaches could be developed for serotype 4 by identifying specific phages or antibodies that recognize the YcjF protein from this serotype. ELISA-based detection systems using recombinant YcjF as a standard or antibodies against YcjF could provide sensitive and specific diagnostic methods, particularly valuable in regions with high Shigella prevalence such as Bangladesh, where S. boydii represents 5.4% of all Shigella infections .

What is the comparative analysis of YcjF across different Shigella serotypes?

The table below presents a comparative analysis of YcjF proteins from different Shigella strains based on available data:

What experimental challenges are associated with studying membrane proteins like YcjF?

Studying membrane proteins like YcjF presents several experimental challenges. Their hydrophobic nature can lead to solubility issues during expression and purification, often requiring detergents or lipid environments to maintain native conformation. When working with recombinant YcjF, researchers must carefully optimize buffer conditions to prevent protein aggregation. Structural studies are particularly challenging, as membrane proteins are difficult to crystallize for X-ray crystallography. Additionally, functional studies may require reconstitution into membrane-like environments such as liposomes or nanodiscs to observe native activity. For immunological studies, the generation of antibodies against specific epitopes may be complicated by the membrane-embedded nature of certain protein regions .

What evolutionary insights can be gained from studying YcjF proteins in different bacterial pathogens?

Evolutionary analysis of YcjF proteins across different bacterial pathogens can provide insights into the conservation and diversification of this membrane protein family. The UPF0283 membrane protein family, to which YcjF belongs, is found across various bacterial species, suggesting an ancient evolutionary origin and important functional roles. Comparing the sequences from Shigella boydii serotype 4 (Q320A9), serotype 18 (B2U0L5), and Shigella dysenteriae (Q9LA29) reveals high conservation with specific variations that may reflect adaptive evolution to different host environments or pathogenic mechanisms . Phylogenetic analysis of YcjF sequences could potentially mirror the evolutionary relationships between different Shigella serotypes and related Enterobacteriaceae, providing insights into bacterial speciation and host adaptation processes.

How does YcjF contribute to the study of Shigella epidemiology?

The YcjF protein can contribute to Shigella epidemiological studies through serotype-specific identification and characterization. In Bangladesh, where S. boydii type 1 is the second most prevalent among 20 serotypes, specific molecular markers like YcjF could help track the distribution and spread of different serotypes . Phage-based diagnostic approaches, as demonstrated with the MK-13 phage for S. boydii type 1, offer rapid and low-cost identification methods particularly valuable in resource-limited settings . Developing similar approaches for serotype 4 could enhance surveillance capabilities. The genetic diversity in the ycjF gene across different isolates might also serve as a molecular clock to understand the evolutionary history and transmission patterns of Shigella boydii in endemic regions.