Recombinant Shigella boydii serotype 4 UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is synthesized in Escherichia coli expression systems, leveraging bacterial scalability and cost-effectiveness. Critical production parameters include:

ParameterSpecification
Host SystemE. coli
FormLyophilized powder or glycerol-stabilized liquid
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) or 50% glycerol
ReconstitutionSterile deionized water (0.1–1.0 mg/mL), with optional glycerol for long-term storage
Storage–20°C/–80°C (long-term); 4°C for working aliquots (≤1 week)

Pathogenicity Studies

While yjjB’s specific role in Shigella virulence is not explicitly detailed in available literature, homologs of UPF0442 proteins in related pathogens are implicated in stress adaptation and metabolic regulation . Shigella virulence mechanisms rely heavily on effector proteins (e.g., IpaB, IpaC, VirG) to invade host cells, suppress immunity, and cause dysentery . yjjB may contribute to similar pathways, warranting further investigation.

Vaccine Development

Protein-based vaccines targeting Shigella are under active exploration. Multiepitope fusion antigens (MEFAs) incorporating conserved epitopes from virulence factors (e.g., IpaB, VirG) have shown cross-protective potential . While yjjB is not yet included in such constructs, its conservation across Shigella serotypes could position it as a candidate for future vaccine designs .

Stability Considerations

The protein’s lyophilized form ensures stability but requires careful reconstitution to avoid aggregation . Repeated freeze-thaw cycles degrade functionality, necessitating aliquot protocols .

Future Directions

  • Functional Characterization: Clarify yjjB’s role in Shigella metabolism or virulence using knockout models .

  • Vaccine Integration: Evaluate yjjB’s immunogenicity alone or as part of MEFA constructs .

  • Structural Analysis: Resolve 3D structures to identify binding partners or enzymatic activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
yjjB; SBO_4423; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yjjB
Target Protein Sequence
MGVIEFLFALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTRGLNIE WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: sbo:SBO_4423

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of yjjB protein in Shigella boydii?

The yjjB protein in Shigella boydii is categorized as a UPF0442 protein with emerging significance in bacterial genetic processes. Research indicates that yjjB may play a role in mobile genetic element movement, particularly in the context of group II intron retrohoming mechanisms. Genetic screens and Taqman qPCR assays have revealed that decreased retrohoming efficiency can result from transposon insertions in the yjjB gene, suggesting its involvement in DNA recombination processes essential to bacterial genetic plasticity . These findings position yjjB as a potentially important factor in horizontal gene transfer and genomic evolution in Shigella species, though its precise biochemical function remains an active area of investigation.

How does yjjB protein expression in Shigella compare to homologous proteins in other enterobacteria?

The yjjB protein expression patterns in Shigella boydii show notable similarities to homologous proteins found in related enterobacteria, particularly Escherichia coli. Comparative genetic studies have identified yjjB as part of a conserved set of proteins involved in bacterial genetic processes. When analyzing expression systems for recombinant production, researchers have observed that yjjB can be successfully expressed in various host systems including E. coli, yeast, mammalian, and insect cell lines . Expression optimization typically requires strain-specific adaptations, with BL21(DE3), JM115, and Rosetta-GAMI bacterial strains commonly used for prokaryotic expression of proteins like yjjB . This cross-species expression capability highlights the evolutionary conservation of yjjB structure and potentially its function across enterobacterial species.

What expression systems are most effective for producing recombinant yjjB protein?

For optimal recombinant production of yjjB protein, several expression systems have demonstrated effectiveness, each with specific advantages depending on research requirements:

Expression SystemRecommended HostOptimal TagsPurification YieldApplication Suitability
E. coliBL21(DE3), Rosetta-GAMIHis, MBP, GSTHigh (>90% purity)Structural studies, antibody production
YeastSMD1168, GS115His, FLAGMedium (>80% purity)Post-translational modification studies
InsectSf9, Sf21HisMedium-High (>85% purity)Complex protein interactions
Mammalian293T, CHOHis, FLAGLow-Medium (>75% purity)Functional studies

What are the recommended protocols for purifying recombinant yjjB protein to achieve >95% purity?

Achieving high-purity recombinant yjjB protein requires a strategic multi-step purification protocol:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is highly effective for His-tagged yjjB, with optimal binding in 50 mM phosphate buffer (pH 7.4) containing 300 mM NaCl and 10 mM imidazole.

  • Intermediate Purification: Size exclusion chromatography using Superdex 75 or 200 columns can separate yjjB protein from contaminants of different molecular weights.

  • Polishing Step: Ion exchange chromatography (typically Q-Sepharose) at pH 8.0 with a linear NaCl gradient (0-500 mM) effectively removes remaining impurities.

For tag-free preparations, initial expression with removable tags (TEV protease-cleavable His tag) followed by tag removal and a second IMAC step (reverse-IMAC) yields highly pure protein . Protein renaturation, endotoxin removal, filtration sterilization, and lyophilization may be necessary depending on downstream applications . When working with potentially difficult-to-express proteins like yjjB, inclusion body solubilization using 8M urea followed by on-column refolding can significantly increase yield while maintaining structural integrity.

How can researchers optimize codon usage for maximum yjjB expression in heterologous systems?

Optimizing codon usage for yjjB expression in heterologous systems requires several coordinated approaches:

Codon adaptation is particularly important when expressing Shigella proteins in systems like yeast or mammalian cells. Professional codon optimization services, often included in recombinant protein expression packages, provide comprehensive sequence engineering followed by gene synthesis and subcloning . This approach has demonstrated success rates exceeding 95% for proteins similar to yjjB across multiple expression systems.

What analytical methods are most sensitive for detecting yjjB protein interactions with host cellular components?

For detecting yjjB protein interactions with host cellular components, several complementary analytical approaches provide comprehensive interaction data:

  • Affinity-Based Methods:

    • Pull-down assays using tagged yjjB to identify direct binding partners

    • Co-immunoprecipitation with anti-yjjB antibodies to capture protein complexes from cellular lysates

    • Chromatin immunoprecipitation (ChIP) if yjjB is suspected to interact with nucleic acids

  • Biophysical Techniques:

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of interactions

    • Microscale thermophoresis (MST) for detecting interactions in near-native conditions

  • Mass Spectrometry-Based Approaches:

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • Thermal proteome profiling (TPP) to detect interactions based on thermal stability shifts

For studying yjjB specifically, proteomic analysis methods have successfully verified the presence of yjjB in protein complexes, similar to approaches used for analyzing outer membrane vesicles (OMVs) from recombinant Shigella strains . When investigating potential roles in genetic processes like retrohoming, combining genetic screens with biochemical assays, such as those using group II intron RNPs with cellular extracts, has proven particularly effective .

How can yjjB be utilized in recombinant vaccine development strategies against Shigella infections?

The potential application of yjjB in recombinant vaccine development draws parallels from successful approaches with other Shigella proteins:

  • Antigen Delivery Platform: yjjB could be incorporated into outer membrane vesicle (OMV)-based vaccine platforms, similar to approaches used with recombinant Shigella flexneri expressing heterologous antigens. This method leverages the natural immunostimulatory properties of bacterial OMVs while delivering specific antigens .

  • Genome Integration Approach: For stable expression, the gene encoding yjjB can be directly integrated into the genome of an attenuated Shigella strain, ensuring consistent production and presentation to the immune system. This strategy has shown promise with other antigens like LTB from enterotoxigenic Escherichia coli (ETEC) .

  • Cross-Protection Strategy: If yjjB contains conserved epitopes across Shigella species, it may serve as a component in broadly protective vaccines targeting multiple serotypes. Analysis would require epitope mapping and immunogenicity studies.

The advantages of this approach include the potential for a stable, non-replicating vaccine platform that can be administered orally, triggering mucosal immunity at the primary site of Shigella infection. Success has been demonstrated with similar approaches using S. flexneri expressing ETEC toxins, where GM1-capture ELISA confirmed successful expression and proteomic analysis verified the presence of the target proteins in isolated vesicles .

What role does yjjB play in group II intron retrohoming, and how might this impact horizontal gene transfer in Shigella?

The yjjB protein has been implicated in group II intron retrohoming mechanisms, with significant implications for horizontal gene transfer in Shigella:

  • Retrohoming Pathway Involvement: Genetic screens and Taqman qPCR assays have identified yjjB among a select group of host factors that significantly impact retrohoming efficiency when disrupted. Transposon insertions in yjjB resulted in measurable decreases in retrohoming, suggesting its functional role in this process .

  • Mechanistic Contribution: While the precise molecular function remains under investigation, yjjB likely participates in the complex multi-step retrohoming process that involves:

    • Recognition of DNA target sequences

    • Reverse splicing of intron RNA into DNA

    • Target DNA-primed reverse transcription (TPRT)

    • Second-strand DNA synthesis

  • Evolutionary Significance: By facilitating retrohoming, yjjB potentially contributes to horizontal gene transfer mechanisms that drive bacterial evolution, antibiotic resistance spread, and virulence factor acquisition in Shigella species.

The decreased retrohoming efficiency observed with yjjB disruption places it among important host factors including DnaC, DnaT, GyrB, and RpoH . This finding suggests yjjB may function within replication or transcription-associated protein complexes that support the integration of mobile genetic elements, though this hypothesis requires further biochemical validation through reconstituted in vitro retrohoming assays.

How do analytical approaches for resolving contradictory data apply to yjjB functional studies?

When confronting contradictory data in yjjB functional studies, researchers should implement structured analytical frameworks:

  • Systematic Contradiction Resolution Protocol:

    • Catalog all contradictory findings using standardized annotation guidelines

    • Classify contradictions into categories (methodological, interpretive, or genuine biological variability)

    • Apply three-way decision frameworks (confirms, contradicts, or insufficient evidence) similar to those used in textual entailment recognition tasks

  • Methodological Triangulation:

    • Validate findings using multiple independent techniques (genetic screens, biochemical assays, and proteomic analyses)

    • Poor correlation between different experimental approaches often indicates indirect effects rather than direct functional relationships, as observed in screenings for retrohoming factors

    • Employ both in vivo and in vitro approaches to distinguish cellular context effects from direct biochemical activities

  • Statistical Analysis for Contradiction Resolution:

    • Implement meta-analytical approaches when multiple studies show conflicting results

    • Consider Bayesian frameworks that can incorporate prior knowledge about protein function

    • Use contradiction datasets and annotation tools developed for textual contradiction detection to formalize the analysis of conflicting scientific findings

When specifically analyzing yjjB function, researchers should be aware that initial transposon library screens identified 68 candidates potentially involved in retrohoming, but further validation through Taqman qPCR significantly narrowed this list, with only 10 candidates showing statistically significant effects . This poor correlation highlights the critical importance of using multiple analytical approaches to distinguish direct functional roles from indirect effects when studying proteins like yjjB.

What strategies can overcome expression challenges when producing recombinant yjjB protein?

Researchers facing difficulties with recombinant yjjB expression can implement several proven troubleshooting strategies:

  • Fusion Tag Selection:

    • For insoluble expression: MBP or GST tags significantly enhance solubility

    • For detection challenges: FLAG or GFP tags improve visualization

    • For purification difficulties: His-tags positioned at either the N- or C-terminus depending on structural considerations

  • Expression Condition Optimization Matrix:

ParameterStandard ConditionOptimization RangeMonitoring Method
Temperature37°C16-30°CSDS-PAGE
IPTG concentration1.0 mM0.1-0.5 mMWestern blot
Media compositionLBTB, 2YT, M9Yield quantification
Induction timeMid-log phaseEarly to late logGrowth curve
  • Host Strain Selection:

    • For codon bias issues: Rosetta-GAMI strains supply rare tRNAs

    • For toxic protein expression: BL21(DE3)pLysS reduces leaky expression

    • For disulfide bond formation: Origami derivatives enhance proper folding

  • Refolding Strategies:

    • On-column refolding for proteins recovered from inclusion bodies

    • Step-wise dialysis with gradually decreasing denaturant concentrations

    • Chaperone co-expression (GroEL/GroES, DnaK/DnaJ/GrpE) to assist folding

When conventional approaches fail, specialized expression services offering guaranteed recombinant protein expression packages may be considered, with success rates exceeding 95% through comprehensive optimization strategies .

How can researchers address inconsistent results when studying yjjB's role in genetic processes?

When confronting inconsistent results in yjjB functional studies, researchers should implement a structured troubleshooting approach:

  • Experimental Design Refinement:

    • Implement multivariate experimental designs that systematically control for confounding factors

    • Develop genetic complementation systems to verify phenotype specificity

    • Employ inducible expression systems to titrate yjjB levels and correlate with phenotypic outcomes

  • Critical Methodology Assessment:

    • Review assay sensitivity and specificity limitations

    • Consider genetic background effects that may mask or enhance yjjB-related phenotypes

    • Cross-validate findings using independent methodological approaches

  • Biological Context Considerations:

    • Evaluate growth conditions that may affect yjjB expression or activity

    • Consider potential redundancy with functionally related proteins

    • Assess post-translational modifications that may alter protein function

The challenge of inconsistent results is exemplified in retrohoming studies, where initial screens identified numerous candidates, but only a small subset demonstrated statistically significant effects in subsequent validation experiments . This highlights the importance of rigorous validation approaches. When studying genetic processes involving yjjB, researchers should combine multiple experimental strategies, such as transposon mutagenesis, qPCR validation, and biochemical reconstitution assays, to distinguish direct functional roles from indirect effects .

What quality control measures ensure reproducibility in yjjB functional assays?

Implementing comprehensive quality control measures is essential for ensuring reproducibility in yjjB functional studies:

  • Protein Quality Assessment Protocol:

    • Purity verification through multiple analytical methods (SDS-PAGE, size exclusion chromatography, mass spectrometry)

    • Functionality testing using activity-specific assays before experimental use

    • Stability monitoring through thermal shift assays and time-course activity measurements

  • Standardized Experimental Controls:

    • Positive and negative controls for each assay type

    • Internal reference standards for normalization across experiments

    • Spike-in controls to assess recovery and detection sensitivity

  • Data Validation Framework:

    • Technical replicates to assess methodological variation

    • Biological replicates to capture natural variability

    • Independent experimental repetition by different researchers

  • Methodological Documentation:

    • Detailed standard operating procedures (SOPs) for all experimental steps

    • Comprehensive reporting of all experimental parameters, including buffer compositions, incubation times, and equipment settings

    • Transparent sharing of raw data and analysis pipelines

For specific applications like group II intron retrohoming assays involving yjjB, implementing dual-marker systems (such as the trimethoprim-resistance retrotransposition-activated genetic marker and GFP expression) provides orthogonal readouts that increase result reliability . Additionally, performing both genetic screens and biochemical reconstitution assays with purified components allows researchers to differentiate direct and indirect effects of yjjB in complex cellular processes .

What emerging technologies could advance our understanding of yjjB structure-function relationships?

Several cutting-edge technologies show particular promise for illuminating yjjB structure-function relationships:

  • Cryo-Electron Microscopy Applications:

    • Single-particle analysis for high-resolution structural determination without crystallization

    • Cryo-electron tomography to visualize yjjB in its cellular context

    • Time-resolved cryo-EM to capture conformational changes during functional cycles

  • Integrative Structural Biology Approaches:

    • Combining X-ray crystallography, NMR, and SAXS data for comprehensive structural models

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

  • Advanced Protein Engineering Methods:

    • Deep mutational scanning to comprehensively map structure-function relationships

    • Ancestral sequence reconstruction to identify evolutionarily conserved functional domains

    • Directed evolution approaches to enhance specific functional properties

  • Computational Prediction Tools:

    • AI-powered structure prediction tools (AlphaFold2, RoseTTAFold) for modeling protein structures

    • Molecular dynamics simulations to study conformational dynamics

    • Quantum mechanics/molecular mechanics (QM/MM) approaches for detailed active site characterization

These technologies could help resolve contradictions in existing data by providing higher-resolution insights into yjjB function, particularly in the context of complex processes like group II intron retrohoming . For example, structural studies could reveal how yjjB interacts with other replication restart proteins and contributes to the initiation of second-strand DNA synthesis in retrohoming pathways.

How might systems biology approaches enhance our understanding of yjjB's role in Shigella pathogenesis?

Systems biology approaches offer powerful frameworks for contextualizing yjjB function within broader Shigella pathogenesis networks:

  • Multi-omics Integration Strategies:

    • Combine transcriptomics, proteomics, and metabolomics data to position yjjB within pathogenicity-relevant pathways

    • Correlate yjjB expression patterns with virulence factor production across infection stages

    • Map post-translational modification landscapes affecting yjjB function during host interaction

  • Network Analysis Applications:

    • Construct protein-protein interaction networks to identify yjjB's functional partners

    • Develop gene regulatory networks to understand transcriptional control of yjjB

    • Implement pathway enrichment analysis to connect yjjB to specific virulence mechanisms

  • Host-Pathogen Interaction Modeling:

    • Develop in silico models predicting how yjjB manipulation affects infection outcomes

    • Simulate evolutionary dynamics of yjjB in response to host immune pressures

    • Create multi-scale models connecting molecular events to tissue-level pathology

  • Comparative Systems Approaches:

    • Analyze yjjB function across Shigella species with varying virulence profiles

    • Compare systems-level effects of yjjB disruption with those of known virulence factors

    • Evaluate conservation of yjjB-dependent processes across enteric pathogens

These approaches could reveal whether yjjB contributes to pathogenesis through its potential role in horizontal gene transfer and mobile genetic element integration, possibly facilitating the acquisition or expression of virulence factors . Additionally, systems approaches could identify whether yjjB participates in vaccine-relevant pathways, informing its potential incorporation into recombinant vaccine strategies similar to those developed for other Shigella antigens .

What are the implications of yjjB research for designing next-generation antimicrobial strategies?

Research on yjjB offers several promising avenues for novel antimicrobial development:

  • Target-Based Drug Design Opportunities:

    • If yjjB proves essential for Shigella viability or virulence, structure-based drug design could yield specific inhibitors

    • Virtual screening against structural models could identify lead compounds disrupting yjjB function

    • Fragment-based approaches could develop inhibitors targeting specific functional domains

  • Anti-virulence Strategies:

    • If yjjB facilitates horizontal gene transfer of virulence or resistance elements, inhibiting its function could reduce pathogenicity without selecting for resistance

    • Targeting yjjB-dependent processes might attenuate virulence without affecting commensal bacteria

  • Vaccine Development Applications:

    • Incorporating yjjB into outer membrane vesicle (OMV) vaccine platforms could enhance immunogenicity

    • Using yjjB as part of multi-antigen vaccines may provide broader protection against Shigella variants

    • The demonstrated approach of genomic integration for stable antigen expression could be applied to yjjB-based vaccines

  • Diagnostic Development:

    • yjjB-specific detection methods could improve Shigella diagnostics

    • Monitoring yjjB expression patterns might provide insights into infection progression

    • Antibodies against yjjB could enable rapid identification of specific Shigella strains

The growing significance of Shigella as a health burden in resource-limited regions, combined with increasing antibiotic resistance, makes these alternative approaches particularly valuable . If yjjB's role in processes like retrohoming proves significant for pathogen evolution or adaptation, targeting these mechanisms could provide novel ways to combat bacterial adaptation while traditional vaccines continue development .

What consensus has emerged regarding yjjB function based on current research findings?

Current research suggests that yjjB functions within a network of proteins involved in genetic mobility and potentially DNA replication or repair processes in Shigella species. Evidence from genetic screens and qPCR validation has positioned yjjB among a select group of host factors that significantly impact group II intron retrohoming efficiency . While the precise biochemical mechanism remains under investigation, yjjB appears to participate in processes related to DNA recombination and mobile genetic element integration, potentially alongside replication restart proteins that play key roles in initiating second-strand DNA synthesis .

What methodological standards should researchers adopt when investigating yjjB function?

Researchers investigating yjjB function should adhere to rigorous methodological standards:

  • Validation Through Multiple Approaches: Employ complementary techniques including genetic screens, biochemical assays, and proteomic analyses to verify findings. Poor correlation between different experimental approaches often indicates indirect effects rather than direct functional relationships .

  • Controlled Expression Systems: Utilize precisely controlled expression systems with appropriate tags for detection and purification, considering that tag position and type can significantly impact protein function and solubility .

  • Comprehensive Controls: Implement positive and negative controls for each experiment, including genetic complementation to verify phenotype specificity and exclude polar effects of genetic manipulations.

  • Standardized Reporting: Document all experimental conditions comprehensively, including expression system details, purification protocols, buffer compositions, and assay parameters to enable reproduction by other laboratories.

  • Data Validation Framework: Employ technical and biological replicates with appropriate statistical analysis to ensure reproducibility, particularly when investigating subtle phenotypes or complex processes like retrohoming .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.