Recombinant Shigella boydii serotype 4 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant YihY is a partial-length (1–290 amino acids) membrane protein encoded by the yihY gene (locus: SBO_3900) in S. boydii serotype 4 (strain Sb227) . Its UniProt ID is Q31UA7, and it features a tris-based buffer formulation with 50% glycerol for stability during storage at -20°C . The protein is produced in E. coli with an N-terminal His tag for purification .

Key sequence regions:

  • Transmembrane domains critical for membrane integration.

  • Antigenic epitopes implicated in immune recognition .

Table 1: Key Features of Recombinant YihY

PropertyDetails
Expression HostEscherichia coli
TagN-terminal His tag
Molecular Weight~33 kDa (calculated)
StorageTris buffer, 50% glycerol; stable at -20°C or -80°C
Immunogenic PotentialInduces IgG/IgA responses and pro-inflammatory cytokines

Role in Vaccine Development

Recombinant YihY has been studied in the context of outer membrane vesicles (OMVs), which are promising vaccine candidates due to their natural antigenic properties.

Table 2: Strategies for Enhancing OMV Immunogenicity

MethodMechanismOutcomeReference
Tol-Pal system disruptionIncreases OMV yield by 60%Boosts mucosal IgG/IgA and cytokines
GMMA (Generalized Modules)High-yield, cost-effective productionBroad-spectrum antibody responses
Multi-OVM Mixing (MOMVs)Combines OMVs from multiple Shigella speciesCross-protection against serotypes

Studies show that OMVs containing YihY elicit TNF-α, IL-6, and IFN-γ in murine models, correlating with 100% protection against shigellosis in neonatal mice .

Research Applications

  1. Diagnostic Tools: YihY-specific phages (e.g., MK-13) enable rapid detection of S. boydii serotype 4 in environmental samples .

  2. Antigenic Studies: Epitope mapping using recombinant YihY aids in identifying conserved regions for pan-Shigella vaccines .

  3. Immune Response Analysis: Subcutaneous administration with adjuvants like dmLT enhances IgG titers, validating its use in adjuvant systems .

Challenges and Future Directions

While recombinant YihY shows promise, limitations include:

  • Variable immunogenicity across Shigella clades .

  • Thermostability issues in resource-limited settings .
    Ongoing work focuses on nanoencapsulation and heat-induced OMV modifications to improve delivery and stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
yihY; SBO_3900; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYHKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links

KEGG: sbo:SBO_3900

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 family and how is yihY classified in bacterial systems?

The UPF0761 designation (Uncharacterized Protein Family 0761) indicates that yihY belongs to a group of proteins with conserved sequences but largely unknown functions. This classification represents proteins awaiting functional characterization despite sequence conservation across multiple bacterial species.

Methodological approach for classification:

  • Conduct sequence alignment analysis using tools like BLAST against characterized protein databases

  • Perform phylogenetic analysis to identify evolutionary relationships with other bacterial proteins

  • Analyze protein domain architecture using tools like InterPro or Pfam

  • Compare transmembrane topology predictions using multiple prediction algorithms (TMHMM, Phobius)

The methodological rigor for classification should mirror approaches used for well-characterized membrane proteins like YidC, which has been studied using evolutionary co-variation analysis to determine its structural arrangement of five transmembrane domains .

How does yihY potentially relate to other membrane proteins in Shigella pathogenesis?

While direct evidence for yihY's role in pathogenesis is limited, methodological approaches can be developed based on the known roles of other Shigella membrane proteins.

Research methodology for investigating pathogenic roles:

  • Generate yihY knockout mutants and assess virulence phenotypes in cellular and animal models

  • Conduct comparative transcriptomics between wild-type and knockout strains during infection

  • Analyze protein expression patterns during different stages of infection using quantitative proteomics

  • Examine potential interactions with host proteins through co-immunoprecipitation studies

Research on other Shigella species has demonstrated that membrane proteins can significantly impact antimicrobial resistance profiles and bacterial survival during infection . Similar approaches could be applied to understand yihY's potential contributions.

What bioinformatic approaches can predict the structure and function of yihY?

Computational methods serve as crucial starting points for characterizing uncharacterized membrane proteins like yihY.

Recommended methodological pipeline:

  • Apply homology modeling based on solved structures of related membrane proteins

  • Use membrane protein-specific structure prediction tools like MEMSAT and OCTOPUS

  • Implement molecular dynamics simulations to study protein behavior in membrane environments

  • Apply machine learning algorithms trained on known membrane protein functions to predict yihY function

Similar approaches have been successfully employed for YidC, where evolutionary co-variation analysis, lipid-versus-protein-exposure analysis, and molecular dynamics simulations yielded a comprehensive structural model that revealed critical functional insights .

What expression systems are optimal for producing functional recombinant yihY protein?

Expression of membrane proteins presents unique challenges requiring specialized methodological approaches.

Recommended expression methodology:

  • Test multiple expression systems (E. coli BL21(DE3), C41/C43, or cell-free systems)

  • Optimize expression using fusion tags (His, MBP, or SUMO) to enhance solubility

  • Implement controlled expression rates using tunable promoters to prevent inclusion body formation

  • Consider membrane-targeted expression systems with signal sequences for proper membrane integration

For example, successful recombinant expression of membrane proteins like YidC has been achieved using His-tagged constructs expressed in E. coli systems, enabling downstream purification and functional analyses .

What purification strategies maintain the native conformation of yihY membrane protein?

Maintaining native protein conformation during purification is critical for functional studies.

Recommended purification protocol:

  • Solubilize membranes using mild detergents (DDM, LMNG, or digitonin)

  • Implement two-step purification: initial IMAC followed by size exclusion chromatography

  • Validate protein quality via analytical techniques (SEC-MALS, DLS, or thermal stability assays)

  • Consider incorporating lipid nanodiscs or amphipols for enhanced stability

This approach parallels successful methodologies used for YidC purification, where DDM detergent solubilization combined with Ni-NTA affinity chromatography yielded functional protein for downstream analyses .

How can researchers evaluate proper folding and functionality of purified yihY?

Verification of proper protein folding and function is essential before proceeding with characterization studies.

Recommended validation methodology:

  • Conduct circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Perform tryptophan fluorescence spectroscopy to evaluate tertiary structure integrity

  • Implement thermal shift assays to measure protein stability in different buffer conditions

  • Develop functional assays based on predicted activities (e.g., lipid interactions, substrate binding)

For membrane proteins like YidC, functional validation has included analysis of proper membrane integration and assessment of interactions with known substrate proteins, providing a methodological framework that could be adapted for yihY .

What techniques are most appropriate for determining the structure of yihY?

Structural determination of membrane proteins requires specialized methodological approaches.

Recommended structural biology workflow:

  • Screen detergent and lipid combinations for crystallization trials

  • Consider lipidic cubic phase (LCP) crystallization for X-ray crystallography

  • Implement single-particle cryo-electron microscopy for structure determination without crystallization

  • Apply NMR spectroscopy for dynamic structural information (particularly for smaller domains)

These approaches mirror successful structural studies of YidC, where researchers combined multiple techniques including evolutionary co-variation analysis and molecular dynamics simulations to develop a comprehensive structural model that revealed functional mechanisms .

How can researchers identify potential binding partners and interactors of yihY?

Identifying protein interaction partners is crucial for understanding yihY's functional context.

Recommended interaction analysis methodology:

  • Implement BioID or APEX proximity labeling in living bacterial cells

  • Conduct pull-down experiments using purified yihY as bait

  • Perform crosslinking mass spectrometry (XL-MS) to identify direct protein contacts

  • Analyze interactors using quantitative SILAC-based proteomics

This methodological approach has proven successful for YidC, where researchers employed BioID to identify YibN as a critical interactor, followed by validation using reciprocal pull-down experiments and native gel electrophoresis to confirm the interaction .

What methods can reveal the membrane topology and integration mechanism of yihY?

Understanding membrane topology is fundamental for membrane protein characterization.

Recommended topology analysis protocol:

  • Implement cysteine accessibility scanning with membrane-impermeable labeling reagents

  • Use protease protection assays to determine cytoplasmic vs. periplasmic domains

  • Apply GFP-fusion analysis for rapid topology assessment

  • Conduct hydrogen-deuterium exchange mass spectrometry for dynamic structural information

Studies of YidC have revealed how single copies of membrane proteins can interact with ribosomes at tunnel exits and mediate protein insertion at protein-lipid interfaces, providing a methodological framework for studying similar processes for yihY .

How can researchers determine if yihY participates in membrane protein insertion like YidC?

Given the established role of YidC in membrane protein insertion, investigating whether yihY has similar functions would be valuable.

Proposed experimental methodology:

  • Develop in vitro translation-translocation assays with purified yihY

  • Create conditional yihY depletion strains and monitor effects on membrane protein integration

  • Conduct site-directed mutagenesis of predicted functional residues and assess activity

  • Implement fluorescence-based assays to monitor real-time insertion of model substrates

This approach builds on established methodologies for YidC, which has been shown to interact with ribosomes at tunnel exits and facilitate membrane protein insertion at the protein-lipid interface .

What experimental approaches can determine yihY's role in antimicrobial resistance?

Given the importance of membrane proteins in antimicrobial resistance, investigating yihY's potential role is valuable.

Recommended resistance analysis methodology:

  • Generate yihY deletion and overexpression strains

  • Perform antimicrobial susceptibility testing with multiple classes of antibiotics

  • Analyze membrane permeability changes using fluorescent dye uptake assays

  • Conduct transcriptomic analysis to identify resistance-associated gene expression changes

Similar approaches have revealed how membrane proteins contribute to antimicrobial resistance in Shigella species, including changes in resistance profiles over time .

How can researchers assess yihY's potential role in membrane integrity and stress response?

Membrane proteins often contribute to maintaining membrane homeostasis and stress response.

Proposed stress response methodology:

  • Expose yihY mutant strains to various stressors (osmotic, pH, temperature)

  • Measure membrane potential and permeability under stress conditions

  • Analyze phospholipid composition changes in response to stress

  • Monitor protein-protein interactions during stress using in vivo crosslinking

This methodological approach parallels studies of YihE kinase, which protects E. coli from antimicrobial and environmental stressors by antagonizing stress response pathways .

How might systems biology approaches integrate yihY into bacterial membrane protein networks?

Systems-level analysis can provide context for yihY's function within broader cellular networks.

Recommended systems biology methodology:

  • Construct protein-protein interaction networks including yihY and related proteins

  • Develop genome-scale metabolic models incorporating membrane protein functions

  • Implement multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Create mathematical models of membrane protein dynamics under different conditions

This approach could help position yihY within functional networks similar to how YidC has been contextualized within membrane protein biogenesis pathways .

What are emerging technologies that could advance understanding of uncharacterized membrane proteins like yihY?

Cutting-edge technologies offer new opportunities for membrane protein characterization.

Recommended emerging methodologies:

  • Apply AlphaFold2 and RoseTTAFold for accurate structure prediction

  • Implement nanobody-assisted structural biology for challenging membrane proteins

  • Use single-molecule tracking in living cells to study dynamic behavior

  • Develop microfluidic-based assays for high-throughput functional screening

These technologies build upon established approaches while offering new capabilities for characterizing challenging membrane proteins like yihY.

TechnologyApplication to yihYAdvantagesTechnical Considerations
AlphaFold2Structure predictionHigh accuracy without experimental structureRequires validation with experimental data
Cryo-EMStructural determinationWorks with smaller protein quantitiesRequires pure, homogeneous samples
Native MSProtein-lipid interactionsPreserves non-covalent interactionsRequires specialized instrumentation
HDX-MSConformational dynamicsMaps protein flexibility and interactionsChallenging data analysis for membrane proteins
Single-molecule FRETReal-time conformational changesCaptures rare/transient statesRequires site-specific labeling

How can yihY research contribute to therapeutic development against Shigella infections?

Translating basic research on yihY to therapeutic applications requires methodological approaches.

Recommended therapeutic research methodology:

  • Conduct epitope mapping to identify potential antibody targets

  • Develop high-throughput screening assays for small molecule inhibitors

  • Implement structure-based drug design if structural information becomes available

  • Evaluate combination therapies targeting multiple membrane proteins

This approach builds on understanding of how membrane proteins contribute to antimicrobial resistance in Shigella species, which has important implications for developing new therapeutic strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.