Recombinant Shigella boydii serotype 4 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To ensure your specified tag, please inform us, and we will prioritize its development.
Synonyms
zntB; SBO_1719; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Shigella boydii serotype 4 (strain Sb227)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links

KEGG: sbo:SBO_1719

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ZntB in Shigella boydii serotype 4?

ZntB from Shigella boydii serotype 4 (strain Sb227) functions as a zinc uptake transporter, contrary to earlier assumptions that suggested an export role. Recent research using reconstituted liposome systems has demonstrated that ZntB mediates Zn²⁺ uptake stimulated by a pH gradient across the membrane . This function is critical for zinc homeostasis in Enterobacteriaceae, where several membrane transporters coordinate to maintain appropriate intracellular zinc concentrations. The protein's role in zinc uptake positions it as an important component in bacterial virulence mechanisms, particularly in zinc-limited environments encountered during host infection .

How is the ZntB protein structurally organized?

ZntB is a membrane protein that belongs to the CorA family of metal ion transporters. The full-length protein consists of 327 amino acids and forms a pentameric assembly . The protein structure includes a large cytoplasmic domain that serves as a regulatory unit for sensing zinc concentrations, connected to a transmembrane domain that forms the transport pathway . The transmembrane region contains the channel pore responsible for zinc movement across the membrane. This structural organization has been confirmed through cryo-electron microscopy studies of ZntB from Escherichia coli, which shares high sequence similarity with the Shigella boydii variant due to their close evolutionary relationship .

What insights does the amino acid sequence provide about ZntB function?

The amino acid sequence of ZntB from Shigella boydii serotype 4 (UniProt ID: Q320D7) reveals important functional domains . The sequence contains hydrophobic transmembrane segments in the C-terminal region that anchor the protein in the membrane and form the transport pore. Several conserved motifs throughout the sequence are likely involved in zinc coordination, including potential metal-binding sites in the cytoplasmic domain . Notably, the presence of histidine residues may contribute to the pH-sensitive transport mechanism, as these residues can function as pH sensors due to their physiologically relevant pKa values . The sequence also reveals that ZntB is encoded by the zntB gene (locus tag SBO_1719), providing context for its genomic organization and potential regulatory relationships .

What are the optimal conditions for expressing and purifying recombinant ZntB?

For successful expression and purification of functional recombinant ZntB, researchers should implement a methodological approach that addresses the challenges typical of membrane protein work:

  • Expression system: E. coli BL21(DE3) or specialized membrane protein expression strains (C41/C43) typically yield good results for ZntB expression.

  • Expression conditions: Induction at lower temperatures (16-18°C) with reduced inducer concentrations (0.1-0.5 mM IPTG) and extended expression times (overnight) helps prevent inclusion body formation.

  • Membrane extraction: Efficient solubilization requires appropriate detergents; n-dodecyl-β-D-maltopyranoside (DDM) or n-decyl-β-D-maltopyranoside (DM) typically maintain ZntB function during extraction.

  • Purification strategy: A combination of affinity chromatography (using His-tags) followed by size exclusion chromatography yields homogeneous protein. The buffer composition during purification should typically contain 150-300 mM NaCl, 20-50 mM Tris or HEPES at pH 7.5-8.0, and appropriate detergent concentrations.

  • Quality control: Size exclusion chromatography with multi-angle light scattering (SEC-MALS) can verify the pentameric assembly integrity of purified ZntB.

How should recombinant ZntB be handled and stored to maintain activity?

Based on product specifications and standard membrane protein protocols, optimal handling and storage conditions for maintaining ZntB activity include:

  • Short-term storage: Store working aliquots at 4°C for up to one week in appropriate buffer .

  • Long-term storage: For extended storage, conserve the protein at -20°C or -80°C. The storage buffer should contain 50% glycerol in a Tris-based buffer optimized for protein stability .

  • Freeze-thaw considerations: Repeated freezing and thawing must be avoided as it leads to protein denaturation and loss of activity. Divide purified protein into single-use aliquots before freezing .

  • Buffer composition: The recommended storage buffer contains Tris-based buffer with 50% glycerol, which has been optimized specifically for this protein .

  • Handling precautions: When working with the protein, maintain samples on ice and use freshly prepared buffers to minimize degradation and oxidation.

What assays effectively measure ZntB transport activity?

Several complementary approaches can be employed to measure ZntB transport activity:

  • Radio-ligand uptake assays: Using radioactive ⁶⁵Zn²⁺ to measure zinc uptake into proteoliposomes containing reconstituted ZntB. This quantitative method allows precise measurement of transport rates under various conditions .

  • Fluorescent transport assays: Zinc-specific fluorescent probes encapsulated within liposomes provide real-time monitoring of zinc uptake. This approach offers advantages in terms of safety and kinetic measurement capabilities .

  • pH gradient-dependent studies: Since ZntB transport is stimulated by pH gradients, assays that establish and monitor proton gradients across liposomal membranes provide insights into the coupling mechanism .

  • Isothermal titration calorimetry (ITC): While not a direct transport assay, ITC measures the thermodynamic parameters of zinc binding to ZntB, providing information about binding affinity, stoichiometry, and the energetics of zinc interaction with the protein .

  • Control experiments: Proper controls must include empty liposomes, denatured protein samples, and experiments with collapsed pH gradients to verify pH-dependent transport activity.

How can the structure-function relationship of ZntB be investigated?

Investigating the structure-function relationship of ZntB requires a multidisciplinary approach:

  • Site-directed mutagenesis: Systematically mutating key residues identified from sequence analysis and structural studies to determine their roles in zinc binding, transport, and pH sensing. Priority targets include:

    • Conserved histidine residues in the transmembrane domain

    • Putative zinc-binding sites in the cytoplasmic domain

    • Residues at the interface between subunits in the pentamer

  • Chimeric protein construction: Creating chimeras between ZntB and related transporters (like CorA) can help identify domains responsible for zinc specificity versus general transport mechanisms.

  • Truncation analysis: Expressing and characterizing truncated versions of ZntB to define the minimum functional unit and understand domain contributions.

  • Cysteine-scanning mutagenesis and accessibility studies: Introducing cysteine residues throughout the protein and testing their accessibility to sulfhydryl reagents can map the transport pathway.

  • Correlation with structural data: Combining functional measurements with structural information from cryo-EM studies to develop comprehensive models of the transport mechanism .

How does the pH gradient influence ZntB transport activity?

The pH-dependent transport mechanism of ZntB can be investigated through these methodological approaches:

  • pH gradient liposome assays: Preparation of proteoliposomes with established pH gradients (inside vs. outside) to measure how transport rates vary with different gradient magnitudes and directions .

  • Site-directed mutagenesis of pH-sensing residues: Identifying and mutating key residues potentially involved in proton sensing or coupling to determine their role in the pH-dependent mechanism.

  • Proton flux measurements: Using pH-sensitive dyes encapsulated in liposomes to simultaneously monitor changes in internal pH and zinc uptake, establishing whether proton influx/efflux occurs during zinc transport.

  • pH-dependent structural studies: Examining whether pH changes induce structural changes in ZntB using techniques like hydrogen-deuterium exchange mass spectrometry.

pH Inside LiposomepH Outside LiposomepH Gradient (ΔpH)Expected ZntB-Mediated Zn²⁺ Uptake
6.57.5+1.0High
7.07.5+0.5Moderate
7.57.50Low
7.56.5-1.0Very low/None

This systematic approach allows quantification of how transport activity correlates with the magnitude and direction of the pH gradient.

What insights can isothermal titration calorimetry provide about ZntB-zinc interactions?

Isothermal titration calorimetry (ITC) offers detailed thermodynamic information about ZntB-zinc interactions :

  • Binding parameters: ITC directly measures:

    • Binding affinity (Kd) for zinc

    • Binding stoichiometry (n)

    • Enthalpy changes (ΔH)

    • Entropy changes (ΔS)

    • Gibbs free energy changes (ΔG)

  • Experimental setup:

    • Purified ZntB (10-50 μM) in ITC cell

    • Zinc solutions (100-500 μM) for titration

    • Temperature control at 25°C

    • Small injection volumes (2-10 μL) with sufficient equilibration time

  • Comparative studies:

    • Measuring binding parameters at different pH values to correlate with transport activity

    • Comparing zinc binding with other divalent cations to establish selectivity profiles

    • Testing mutant proteins to identify key residues involved in zinc coordination

  • Data interpretation:

    • Endothermic versus exothermic binding provides insights into conformational changes

    • Stoichiometry indicates the number of zinc binding sites per pentamer

    • Entropy/enthalpy compensation patterns can suggest binding mechanisms

  • Integration with structural data:

    • Correlating binding sites identified from ITC with structural features observed in cryo-EM models

    • Using ITC to validate computational docking of zinc to predicted binding sites

How does ZntB from Shigella boydii compare to ZntB from E. coli?

ZntB from Shigella boydii serotype 4 and E. coli share significant similarities due to their close evolutionary relationship:

  • Evolutionary context: Shigella strains are essentially clones of E. coli that emerged relatively recently, explaining the high sequence and functional conservation between their ZntB proteins .

  • Sequence homology: High sequence similarity reflects their close phylogenetic relationship, making E. coli ZntB a valid structural and functional model for understanding the Shigella variant .

  • Structural organization: Both proteins form pentameric assemblies with similar domain organization, including a large cytoplasmic regulatory domain and a transmembrane transport domain .

  • Transport mechanism: Both function as zinc importers stimulated by proton gradients, rather than exporters as previously thought. This functional characterization represents a significant revision of our understanding of these transporters .

  • Genomic context: While functionally similar, there may be differences in gene regulation between the two organisms, reflecting their adaptation to different ecological niches and pathogenic lifestyles .

What distinguishes ZntB from its homolog CorA in terms of transport mechanism?

Despite belonging to the same superfamily of transporters, ZntB and CorA exhibit distinct transport mechanisms:

  • Substrate specificity: CorA primarily transports magnesium (Mg²⁺), while ZntB is specific for zinc (Zn²⁺). This difference in ion selectivity is determined by the properties of the ion-binding sites within the pore region .

  • Energy coupling: ZntB transport is stimulated by proton gradients, suggesting a secondary active transport mechanism. In contrast, CorA functions as an ion channel, with Mg²⁺ moving through the pore according to its electrochemical gradient without direct coupling to another energy source .

  • Gating mechanism: CorA channels have a well-characterized gating mechanism involving Mg²⁺ binding to the cytoplasmic domain. The gating mechanism of ZntB appears to be distinct, likely involving both zinc sensing and proton coupling .

  • Structural differences: While both form pentameric assemblies, the detailed structures of their transmembrane domains and ion-conducting pathways differ, reflecting their specialized functions .

  • Transport direction: Research has clarified that ZntB functions as a zinc importer, contrary to previous assumptions of an export role, further differentiating it mechanistically from CorA .

How do ZntB transporters contribute to zinc homeostasis in bacteria?

ZntB transporters function within a complex network of zinc homeostasis mechanisms in bacteria:

What are common challenges in expressing and purifying functional recombinant ZntB?

Researchers working with recombinant ZntB face several technical challenges:

  • Low expression levels: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage, use specialized expression strains like C41(DE3), and test different induction conditions (temperature, inducer concentration, duration).

  • Protein misfolding and aggregation: Improper folding leads to inclusion body formation.

    • Solution: Lower induction temperature (16-20°C), reduce inducer concentration, and consider fusion partners like MBP (maltose-binding protein) that can enhance solubility.

  • Inefficient membrane extraction: Poor solubilization from membranes limits yield.

    • Solution: Screen different detergents and optimize detergent-to-protein ratios. Consider testing detergent mixtures for improved extraction efficiency.

  • Protein instability during purification: Loss of the pentameric assembly affects function.

    • Solution: Include stabilizing agents like glycerol (10-20%) and consider adding low concentrations of lipids in purification buffers.

  • Maintaining the native oligomeric state: The pentameric structure is essential for function.

    • Solution: Use gentle purification conditions, avoid harsh pH or ionic strength changes, and validate oligomeric state using SEC-MALS or native PAGE throughout purification.

How can researchers optimize liposome reconstitution for ZntB functional studies?

Liposome reconstitution is critical for functional studies of membrane transporters like ZntB:

  • Lipid composition: The choice of lipids significantly impacts protein function.

    • Recommendation: Use a mixture resembling bacterial membranes (E. coli polar lipid extract with phosphatidylcholine and potentially cardiolipin).

    • Systematic testing of different lipid compositions can identify optimal conditions.

  • Protein-to-lipid ratio: Typical ratios range from 1:100 to 1:1000 (w/w).

    • Lower ratios ensure most liposomes contain single transporters

    • Higher ratios increase signal in transport assays but risk protein crowding effects

  • Reconstitution methods:

    • Detergent dialysis: Slow removal of detergent allows gradual incorporation

    • Detergent adsorption using Bio-Beads: More rapid method that often yields more homogeneous proteoliposomes

    • Freeze-thaw cycles: Improve protein distribution across liposomes

  • Size control: Extrusion through polycarbonate filters (100-400 nm) creates uniformly sized liposomes, improving reproducibility of transport assays.

  • Quality control: Verify successful reconstitution through:

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Protease protection assays to determine protein orientation

    • Dynamic light scattering to confirm liposome size distribution

What controls are essential for validating ZntB transport activity?

Robust control experiments are essential for reliable interpretation of ZntB transport assays:

  • Empty liposome controls: Liposomes prepared by the same protocol but without protein incorporation control for non-specific zinc permeability or binding to lipid membranes.

  • Denatured protein controls: ZntB proteoliposomes subjected to heat denaturation (95°C for 10 minutes) control for protein-dependent but non-functional zinc association.

  • pH gradient controls: Multiple conditions should be tested:

    • With physiological pH gradient (driving transport)

    • Without pH gradient (minimal transport expected)

    • With reversed pH gradient (should inhibit transport)

    • With protonophores like CCCP to collapse pH gradients

  • Competitive inhibition controls: Addition of excess non-radioactive zinc in radioisotope assays confirms specificity of measured transport.

  • Metal selectivity controls: Testing transport of other divalent cations (Mg²⁺, Ca²⁺, Ni²⁺, Co²⁺) determines the selectivity profile.

  • Time-dependent measurements: Initial rates versus equilibrium measurements distinguish transport from binding phenomena.

  • Concentration-dependent measurements: Varying zinc concentrations can establish kinetic parameters (Km, Vmax) and identify potential cooperative effects.

A systematic experimental design matrix should include all these controls to enable confident interpretation of results and distinguish genuine transport activity from artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.