Recombinant Shigella dysenteriae serotype 1 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; SDY_4534; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella dysenteriae serotype 1 (strain Sd197)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: sdy:SDY_4534

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Shigella dysenteriae serotype 1 ubiA protein?

The Shigella dysenteriae serotype 1 ubiA protein shares significant structural homology with other bacterial UbiA proteins. Based on crystallographic studies of related archaeal UbiA, the protein consists of nine transmembrane helices and an extramembrane cap domain that together form a large central cavity containing the active site . The active site features an unusual lateral opening to the lipid bilayer, facilitating substrate access and product release directly into the membrane environment. This architecture is critical for the enzyme's function in the prenylation of 4-hydroxybenzoate.

The protein contains two conserved aspartate-rich motifs (NDXXD) that coordinate essential magnesium ions required for catalysis. These structural features enable ubiA to function efficiently within the membrane environment where it must interact with both water-soluble and lipid-soluble substrates. The transmembrane regions anchor the protein firmly in the bacterial inner membrane, positioning the active site optimally for catalysis.

What is the role of ubiA in the ubiquinone biosynthetic pathway in Shigella?

In Shigella, ubiA catalyzes a critical prenylation reaction that represents the first committed step in ubiquinone biosynthesis. Specifically, ubiA transfers a prenyl group (typically octaprenyl in bacteria) from octaprenyl diphosphate to 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate. This prenylation reaction is essential for creating the lipophilic side chain of ubiquinone that anchors it within the membrane.

The prenylated product subsequently undergoes a series of modifications:

  • Decarboxylation (by UbiD/UbiX)

  • Hydroxylation steps (by UbiI/UbiH/UbiF in aerobic conditions)

  • O-methylation reactions (by UbiE and UbiG)

These modifications ultimately yield ubiquinone (coenzyme Q), an essential electron carrier in the respiratory chain. Recent research in E. coli (closely related to Shigella) has revealed that bacteria possess both aerobic and anaerobic pathways for ubiquinone biosynthesis . The anaerobic pathway employs a subset of enzymes from the aerobic pathway, including UbiA, but utilizes alternative mechanisms for reactions that typically require molecular oxygen.

This metabolic flexibility allows Shigella to synthesize ubiquinone under various environmental conditions encountered during infection, from oxygen-rich external environments to relatively anaerobic conditions within the host intestine.

How can site-directed mutagenesis inform our understanding of ubiA's catalytic mechanism?

Site-directed mutagenesis represents a powerful approach to deconstruct the catalytic mechanism of Shigella dysenteriae ubiA by systematically altering specific residues and assessing the functional consequences. Based on structural insights from related UbiA proteins , several key targets for mutagenesis include:

  • Aspartate-rich motifs: Mutation of conserved aspartate residues in the NDXXD motifs can reveal their individual contributions to magnesium coordination and catalysis. Sequential replacement with alanine or asparagine can distinguish between structural and catalytic roles.

  • Substrate binding residues: Mutations in the 4-hydroxybenzoate binding pocket or prenyl diphosphate binding site can elucidate substrate specificity determinants and binding mechanisms. Conservative substitutions (e.g., phenylalanine to tyrosine) can reveal the importance of specific chemical interactions.

  • Active site residues: Basic residues potentially involved in deprotonation of 4-hydroxybenzoate can be mutated to assess their role in the reaction mechanism. Substitutions that alter charge (e.g., lysine to methionine) are particularly informative.

  • Membrane interface residues: Mutations at the lateral opening can reveal how substrate access and product release are controlled. Introducing bulkier residues can test the importance of the lateral gateway.

The methodological workflow should include:

  • Generation of a high-quality homology model based on crystallographic structures

  • Expression and purification of mutant proteins using established protocols

  • Enzymatic assays measuring prenylation activity with radiolabeled or HPLC-detectable substrates

  • Kinetic analysis (Km, kcat, kcat/Km) to quantify effects on catalysis and substrate binding

  • Structural analysis (CD spectroscopy, thermal stability) to confirm proper folding

Such systematic mutagenesis studies can provide a comprehensive map of structure-function relationships in ubiA and reveal the molecular basis of catalysis in this important membrane enzyme.

What are the differences between aerobic and anaerobic ubiquinone biosynthesis in Shigella?

Shigella, like its close relative E. coli, likely possesses distinct aerobic and anaerobic pathways for ubiquinone biosynthesis that allow adaptation to varying oxygen availability. Research in E. coli has revealed fundamental differences between these pathways :

Aerobic Pathway:

  • Utilizes oxygen-dependent hydroxylases (UbiI, UbiH, UbiF) that directly incorporate oxygen into ubiquinone precursors

  • Molecular oxygen serves as the terminal electron acceptor during hydroxylation reactions

  • Proceeds through oxidized intermediates requiring oxygen for their formation

  • More energy-efficient when oxygen is available

Anaerobic Pathway:

  • Employs oxygen-independent mechanisms for reactions that typically require molecular oxygen

  • Utilizes alternative enzymes including UbiU, UbiV, and UbiT identified in E. coli

  • These proteins appear to catalyze hydroxylation reactions through a unique oxygen-independent process

  • Expression is regulated by the oxygen-sensing Fnr transcriptional regulator

The ubiA enzyme itself performs the same prenylation reaction in both pathways, but the subsequent processing of its product differs significantly. In the anaerobic pathway, the UbiU and UbiV proteins appear to form a complex that contributes to the hydroxylation of ubiquinone precursors through a mechanism that remains to be fully elucidated.

Of particular interest is the UbiT protein, which has been shown in E. coli to play a crucial role in allowing bacteria to transition efficiently from anaerobic to aerobic conditions . This adaptation capability is likely important for Shigella during infection as it navigates through environments with varying oxygen availability.

Research methods to investigate these pathways in Shigella include:

  • Gene knockout studies targeting pathway-specific enzymes

  • Metabolic labeling experiments under controlled oxygen conditions

  • Comparative proteomics to identify differentially expressed pathway components

  • Isolation and characterization of pathway intermediates

Understanding these parallel biosynthetic routes may reveal new targets for antimicrobial development that could disrupt Shigella's metabolic flexibility.

How could structural insights into ubiA contribute to novel antimicrobial development?

The structural features of ubiA present several opportunities for targeted antimicrobial development against Shigella dysenteriae:

  • Unique Active Site Architecture: The unusual lateral opening to the membrane observed in UbiA structures represents a distinctive target for small molecule inhibitors. This lateral gateway controls substrate access and product release, making it a potential site for competitive or allosteric inhibition.

  • Species-Specific Structural Differences: Comparative analysis between bacterial ubiA and human homologs can identify structural differences that enable selective targeting. Focusing on regions with low sequence conservation but high structural importance can yield antimicrobials with minimal effects on human cells.

  • Rational Inhibitor Design Approach:

    Design StrategyTarget SitePotential Advantage
    Competitive inhibitors4-hydroxybenzoate binding siteDirect blockage of substrate binding
    Prenyl donor analogsPrenyl diphosphate binding siteExploitation of the large hydrophobic pocket
    Transition state mimicsCatalytic centerHigh-affinity binding to enzyme
    Allosteric inhibitorsInterdomain interfacesDisruption of conformational changes
    Metal chelatorsMagnesium binding sitesInterference with essential cofactor binding
  • Structure-Based Screening Methods: Virtual screening against the ubiA structure can identify lead compounds from chemical libraries. Molecular docking simulations can predict binding modes and affinities, prioritizing compounds for experimental testing.

  • Fragment-Based Approaches: Identification of small molecular fragments that bind to different regions of ubiA can serve as starting points for inhibitor development. These fragments can be linked or expanded to create high-affinity compounds.

Recent outbreaks of extensively drug-resistant Shigella highlight the urgent need for novel antimicrobials. Targeting ubiquinone biosynthesis is particularly promising because:

  • It disrupts energy metabolism, a fundamental requirement for bacterial survival

  • The pathway differs significantly from human ubiquinone synthesis

  • Inhibition would affect both aerobic and anaerobic growth

  • The membrane localization of ubiA may facilitate drug access without requiring cellular penetration

Development of ubiA inhibitors could address the growing challenge of antimicrobial resistance in Shigella while providing new treatment options for difficult-to-treat infections.

What are the optimal conditions for expressing and purifying recombinant Shigella dysenteriae ubiA?

Successful expression and purification of recombinant Shigella dysenteriae ubiA requires specialized approaches for membrane proteins. Based on protocols for related ubiA proteins , the following optimized methodology is recommended:

Expression System Optimization:

  • Host strain: E. coli C43(DE3) or LOBSTR-BL21(DE3), which are engineered for membrane protein expression

  • Vector: pET-28a(+) with N-terminal His6-tag for purification

  • Promoter: T7 promoter with lac operator for tight regulation

  • Culture conditions:

    • Initial growth at 37°C until OD600 = 0.6-0.8

    • Temperature reduction to 18°C prior to induction

    • Induction with 0.5 mM IPTG

    • Extended expression period (16-20 hours) at 18°C

Cell Lysis and Membrane Preparation:

  • Resuspension buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 10% glycerol, 1 mM PMSF, protease inhibitor cocktail

  • Mechanical disruption: French press (15,000 psi) or sonication (10 cycles of 30s on/30s off)

  • Membrane isolation: Ultracentrifugation at 100,000 × g for 1 hour at 4°C

  • Membrane solubilization: 1% n-Dodecyl β-D-maltoside (DDM) in solubilization buffer for 1-2 hours at 4°C with gentle rotation

Purification Protocol:

Purification StepBuffer CompositionCritical Parameters
Ni-NTA affinity50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 20-300 mM imidazole gradientFlow rate: 0.5 ml/min; Elution with 250-300 mM imidazole
Size exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDMColumn: Superdex 200; Flow rate: 0.3 ml/min
Optional ion exchange20 mM Tris-HCl pH 8.0, 0.03% DDM, 50-500 mM NaCl gradientColumn: Resource Q; Flow rate: 0.5 ml/min

Final Preparation and Storage:

  • Concentration using 50 kDa MWCO centrifugal concentrators

  • Addition of glycerol to 50% final concentration

  • Flash-freezing in liquid nitrogen

  • Storage at -80°C in small aliquots to prevent repeated freeze-thaw cycles

Quality Control Measures:

  • SDS-PAGE analysis (>90% purity expected)

  • Western blot confirmation with anti-His antibodies

  • Size exclusion chromatography to confirm monodispersity

  • Preliminary activity testing with 4-hydroxybenzoate and prenyl donor substrates

This optimization protocol accounts for the challenges in expressing membrane proteins while maximizing yield and ensuring functional integrity of the purified enzyme.

What enzymatic assays can accurately measure ubiA activity in vitro?

Several complementary assays can be employed to accurately measure the enzymatic activity of Shigella dysenteriae ubiA in vitro, each with specific advantages:

  • Radioisotope-Based Assay

    This gold-standard approach directly measures product formation by tracking the incorporation of radiolabeled substrate into the prenylated product.

    Protocol Components:

    • Reaction mixture: 50 mM Tris-HCl pH 7.5, 5 mM MgCl2, 0.1% DDM, 1 mM DTT

    • Substrates: 50 μM [14C]-4-hydroxybenzoate, 100 μM octaprenyl diphosphate

    • Purified ubiA: 0.1-1 μg per reaction

    • Incubation: 30°C for 30 minutes

    • Extraction: 1:1 chloroform:methanol

    • Analysis: Thin-layer chromatography followed by autoradiography or scintillation counting

    Data Interpretation: Quantification of radioactive product spots provides direct measurement of enzyme activity in picomoles of product formed per minute per milligram of enzyme.

  • HPLC-Based Assay

    This non-radioactive alternative allows separation and quantification of reaction products.

    Protocol Components:

    • Reaction mixture: Same as radioisotope assay but with unlabeled 4-hydroxybenzoate

    • Extraction: Ethyl acetate or hexane

    • HPLC conditions: C18 reverse-phase column, methanol/water gradient with 0.1% formic acid

    • Detection: UV absorbance at 254 nm

    Validation: Standard curves using synthetic 3-octaprenyl-4-hydroxybenzoate ensure accurate quantification.

  • Mass Spectrometry-Based Assay

    This highly specific method enables direct detection and quantification of reaction products.

    Protocol Components:

    • LC-MS/MS analysis using multiple reaction monitoring

    • Internal standards for accurate quantification

    • Chromatographic separation: C8 or C18 column with methanol/water gradient

    Data Analysis: Extracted ion chromatograms for product identification and quantification

Optimization Parameters for All Assays:

ParameterRange to TestOptimal Conditions
pH6.5-9.0Typically 7.5-8.0
Temperature25-45°CUsually 30-37°C
Mg2+ concentration1-20 mMTypically 5-10 mM
Detergent typeDDM, LDAO, Triton X-100DDM is generally preferred
Detergent concentration0.01-0.5%0.03-0.1%
Substrate ratioVarious1:2 4-HB:prenyl donor

When establishing kinetic parameters, it's essential to vary each substrate concentration independently while maintaining the other at saturating levels. This approach yields accurate Km and kcat values for both substrates, providing insights into the enzyme's catalytic mechanism and efficiency.

How can researchers investigate ubiA-membrane interactions in a native-like environment?

Investigating the interactions between ubiA and the membrane environment requires specialized techniques that preserve the native interactions while enabling detailed analysis:

  • Nanodisc Reconstitution System

    This approach incorporates ubiA into nanometer-scale discoidal lipid bilayers stabilized by membrane scaffold proteins, creating a native-like membrane environment.

    Methodology:

    • Purify ubiA in detergent as described previously

    • Mix with appropriate lipids (typically E. coli polar lipid extract) and MSP1D1 scaffold protein

    • Remove detergent using Bio-Beads or dialysis

    • Purify reconstituted nanodiscs by size exclusion chromatography

    Advantages: Defined lipid composition, compatibility with numerous analytical techniques, elimination of detergent effects

  • Site-Directed Spin Labeling Combined with EPR Spectroscopy

    This technique provides information about local environment, accessibility, and dynamics of specific residues.

    Experimental Approach:

    • Generate cysteine mutants at positions of interest throughout ubiA

    • Label with methanethiosulfonate spin label

    • Perform continuous wave EPR measurements to determine:

      • Membrane immersion depth

      • Local polarity

      • Conformational flexibility

    Key Regions to Target: The nine transmembrane helices, the lateral opening, and the membrane-water interface

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

    This method measures the rate of hydrogen-deuterium exchange to identify regions of the protein that interact with the membrane.

    Protocol Overview:

    • Reconstitute ubiA in detergent micelles or nanodiscs

    • Expose to D2O buffer for varying times

    • Quench exchange reaction

    • Digest with pepsin

    • Analyze peptides by LC-MS

    Data Interpretation: Reduced exchange rates indicate regions protected by membrane interaction or tight structural packing

  • Molecular Dynamics Simulations

    Computational approach providing atomic-level insights into protein-lipid interactions.

    Simulation Parameters:

    • Embed ubiA homology model in a lipid bilayer mimicking bacterial membrane composition

    • Run extended simulations (>100 ns) to observe stable protein-lipid interactions

    • Analyze:

      • Specific lipid binding sites

      • Membrane deformation around the protein

      • Dynamics of the lateral opening

      • Water penetration into the active site

  • Lipid Dependence of Enzymatic Activity

    Systematic analysis of how membrane composition affects ubiA function.

    Experimental Design:

    Lipid VariableMethodExpected Impact
    Head group compositionVary PE/PG/CL ratios in liposomesAffects surface charge and protein orientation
    Acyl chain lengthCompare C14-C22 phospholipidsInfluences hydrophobic matching with transmembrane helices
    Membrane fluidityIncorporate cholesterol or vary temperatureAffects lateral mobility and conformational flexibility
    Lipid packingUse different PE:PC ratiosImpacts lateral pressure profile and protein conformational states
  • Fluorescence-Based Approaches

    These techniques can provide information about protein-membrane dynamics.

    Methods Include:

    • Tryptophan fluorescence scanning to map membrane-protein interfaces

    • Fluorescence quenching with brominated lipids to identify specific lipid binding sites

    • FRET between labeled ubiA and membrane probes to measure distances

How does ubiquinone biosynthesis contribute to Shigella pathogenesis and survival in host environments?

Ubiquinone biosynthesis plays crucial roles in Shigella pathogenesis and survival through several interconnected mechanisms:

  • Energy Production During Infection

    Ubiquinone serves as an essential electron carrier in the respiratory chain, enabling efficient ATP production. This energy generation is particularly important during various stages of infection:

    • During initial colonization when bacteria must multiply rapidly

    • Throughout intracellular replication following epithelial cell invasion

    • When facing host immune responses that increase metabolic demands

    The ubiA enzyme, by catalyzing the first committed step in ubiquinone biosynthesis, is central to maintaining this energy production capacity.

  • Adaptation to Varying Oxygen Environments

    As Shigella transitions between environments with different oxygen availabilities during infection, its ability to synthesize ubiquinone under both aerobic and anaerobic conditions becomes critical:

    • In the oxygen-rich external environment before infection

    • In the relatively anaerobic conditions of the intestinal lumen

    • In the microaerobic environment within host cells

    The dual aerobic/anaerobic pathways for ubiquinone biosynthesis (involving UbiU, UbiV, and UbiT identified in related bacteria) likely provide Shigella with metabolic flexibility during these transitions.

  • Resistance to Oxidative Stress

    Ubiquinone functions as an antioxidant within bacterial membranes, helping to neutralize reactive oxygen species generated by:

    • Host immune cells during infection

    • Normal aerobic metabolism

    • Exposure to antibiotics that induce oxidative stress

    This protective function may be particularly important for Shigella's intracellular survival within macrophages and epithelial cells where oxidative bursts are common defense mechanisms.

  • Connection to Virulence Factor Expression

    Emerging evidence suggests links between bacterial energy metabolism and virulence factor expression. The metabolic state influenced by ubiquinone availability may serve as a regulatory signal that coordinates:

    • Type III secretion system assembly and function

    • Timing of virulence factor production

    • Stress response pathways that contribute to pathogenesis

  • Resistance to Membrane-Targeting Host Defenses

    Ubiquinone contributes to membrane stability and integrity, potentially protecting Shigella against:

    • Antimicrobial peptides produced by the host

    • Bile salts encountered in the intestine

    • Membrane-destabilizing components of the innate immune response

The importance of ubiquinone biosynthesis is underscored by observations in the related Flexyn2a Shigella vaccine study , where metabolic attenuation strategies affecting energy production pathways show promise for vaccine development. Understanding how ubiquinone biosynthesis contributes to pathogenesis could similarly inform future therapeutic and preventive approaches against shigellosis.

What insights have recent structural studies provided about ubiA catalytic mechanisms?

Recent structural studies of UbiA superfamily enzymes have revolutionized our understanding of the catalytic mechanisms of these integral membrane prenyltransferases. The crystal structures of archaeal UbiA in both apo and substrate-bound states at 3.3 and 3.6 angstrom resolution have provided several groundbreaking insights:

  • Novel Active Site Architecture

    The structures revealed a unique active site configuration with several distinctive features:

    • A large central cavity containing the active site

    • Nine transmembrane helices surrounding this cavity

    • An extramembrane cap domain that encloses the active site from above

    • A lateral opening to the lipid bilayer that permits substrate access and product release

    This architecture explains how ubiA can catalyze reactions involving both water-soluble (4-hydroxybenzoate) and lipid-soluble (prenyl diphosphate) substrates within the membrane environment.

  • Substrate Binding Mechanisms

    Structural analyses have revealed specific binding sites for both substrates:

    • The 4-hydroxybenzoate binding pocket is formed by conserved residues from multiple transmembrane helices

    • The prenyl diphosphate binding site includes the conserved aspartate-rich motifs that coordinate essential magnesium ions

    • The binding orientation positions the reactive centers of both substrates for efficient catalysis

  • Catalytic Mechanism Insights

    The structural data supports a reaction mechanism involving:

    • Activation of the prenyl diphosphate through magnesium coordination

    • Generation of a carbocation intermediate following diphosphate departure

    • Deprotonation of the 4-hydroxybenzoate hydroxyl group by a conserved base

    • Nucleophilic attack by the activated hydroxyl on the prenyl carbocation

    • Product release through the lateral gate into the membrane

  • Conformational Changes During Catalysis

    Comparison of apo and substrate-bound structures revealed significant conformational changes:

    • Movement of the cap domain to control substrate access

    • Rearrangement of transmembrane helices during the catalytic cycle

    • Dynamic behavior of the lateral gate to facilitate product release

    These conformational changes appear to be essential for the catalytic cycle and represent potential targets for inhibitor design.

  • Structural Basis for Disease-Related Mutations

    The structures have helped rationalize how mutations in UbiA superfamily members can lead to human diseases:

    • Mutations affecting the active site architecture disrupt catalytic efficiency

    • Alterations in the transmembrane helices can affect membrane integration

    • Changes in the lateral gate may impair substrate access or product release

These structural insights provide a framework for understanding ubiA function across bacterial species, including Shigella dysenteriae, and offer new opportunities for structure-based drug design targeting this essential enzyme.

How might ubiA inhibition affect extensively drug-resistant Shigella strains?

The emergence of extensively drug-resistant (XDR) Shigella strains, including the novel XDR Shigella sonnei recently identified in Los Angeles , presents an urgent challenge for infectious disease management. ubiA inhibition represents a promising strategy against these resistant strains for several reasons:

  • Novel Target Outside Current Resistance Mechanisms

    The recently identified XDR Shigella sonnei strain demonstrates resistance to multiple antibiotics including azithromycin, ciprofloxacin, ceftriaxone, trimethoprim-sulfamethoxazole, and ampicillin . These antibiotics target cell wall synthesis, protein synthesis, DNA replication, and folate metabolism—not ubiquinone biosynthesis. Therefore:

    • ubiA inhibitors would act through a mechanism distinct from existing antibiotics

    • Cross-resistance is unlikely given the novel target

    • Combination therapy with existing antibiotics might enhance efficacy through complementary mechanisms

  • Metabolic Vulnerability in Resistant Strains

    XDR strains may face increased metabolic demands due to the energetic costs of resistance mechanisms:

    • Efflux pump operation requires significant energy

    • Production of modified target proteins can increase metabolic burden

    • Altered membrane permeability may necessitate compensatory metabolic adjustments

    By targeting ubiquinone biosynthesis, ubiA inhibitors would compromise energy production precisely when resistant bacteria face heightened energy demands.

  • Potential Impact on Specific Resistance Mechanisms

    Resistance MechanismImpact of ubiA InhibitionRationale
    Efflux pump overexpressionSevere impairmentPumps require proton motive force dependent on ubiquinone
    Target modificationModerate effectEnergy shortage affects protein synthesis and modification
    Enzymatic inactivation of antibioticsSignificant reductionInactivating enzymes require energy for production and function
    Biofilm formationSubstantial disruptionBiofilm formation is energy-intensive and regulated by metabolic status
  • Potential for Restored Sensitivity to Conventional Antibiotics

    ubiA inhibition could potentially restore sensitivity to conventional antibiotics in resistant strains by:

    • Reducing energy available for efflux pump operation

    • Compromising membrane integrity, increasing permeability to antibiotics

    • Disrupting metabolic adaptations that support resistance mechanisms

    This sensitization effect could rejuvenate existing antibiotic arsenals against XDR Shigella strains.

  • Challenges and Considerations

    Several factors must be considered when developing ubiA inhibitors against XDR Shigella:

    • Selectivity over human homologs to minimize toxicity

    • Pharmacokinetic properties suitable for gastrointestinal infections

    • Potential for resistance development through alternative metabolic pathways

    • Optimized delivery to ensure inhibitors reach intracellular bacteria

The extensive drug resistance observed in emerging Shigella strains , including the novel genetic lineage identified in Los Angeles, underscores the urgent need for new therapeutic approaches. Targeting ubiA represents a promising strategy that could address the growing public health threat posed by these difficult-to-treat infections.

What emerging technologies could enhance our understanding of ubiA function and inhibition?

Several cutting-edge technologies hold promise for advancing our understanding of Shigella dysenteriae ubiA function and developing effective inhibitors:

  • Cryo-Electron Microscopy (Cryo-EM)

    Recent advances in cryo-EM now enable high-resolution structural determination of membrane proteins without crystallization:

    • Advantages for ubiA research:

      • Visualization in more native-like lipid environments

      • Capture of multiple conformational states

      • Study of protein-protein interactions in the membrane

    • Applications:

      • Determining structures of ubiA-inhibitor complexes

      • Visualizing conformational changes during catalysis

      • Examining interactions with other ubiquinone biosynthetic enzymes

  • Single-Molecule Techniques

    These approaches can reveal dynamic aspects of enzyme function not accessible through ensemble measurements:

    • Single-molecule FRET to track conformational changes during catalysis

    • Force spectroscopy to measure protein-substrate binding interactions

    • Single-particle tracking to observe diffusion and clustering in membranes

  • Native Mass Spectrometry

    This emerging technique can analyze membrane proteins with bound lipids, detergents, and small molecules:

    • Direct observation of ubiA-substrate complexes

    • Detection of specific lipid interactions

    • Screening of inhibitor binding without crystallization

  • CRISPR-Based Technologies

    Advanced genome editing approaches offer new possibilities:

    • CRISPR interference for precise modulation of ubiA expression

    • Base editing for introducing specific mutations without selection markers

    • CRISPRi screens to identify genetic interactions with ubiA

  • Microfluidic Systems and Organ-on-a-Chip

    These platforms can mimic complex infection environments:

    • Intestinal epithelium models to study ubiA function during infection

    • Oxygen gradient systems to investigate aerobic/anaerobic transitions

    • Real-time monitoring of bacterial responses to ubiA inhibition

  • Artificial Intelligence and Computational Approaches

    AI/Computational MethodApplication to ubiA Research
    Deep learning for protein structure predictionImproved homology models of Shigella dysenteriae ubiA
    Molecular dynamics with enhanced samplingExploration of conformational landscape and substrate binding pathways
    Machine learning for drug discoveryVirtual screening and optimization of potential ubiA inhibitors
    Quantum mechanics/molecular mechanics (QM/MM)Detailed investigation of the catalytic mechanism
  • Metabolic Flux Analysis with Stable Isotopes

    This approach can quantify how ubiA inhibition affects global metabolism:

    • 13C-labeled precursor studies to track carbon flow through ubiquinone biosynthesis

    • Metabolomic profiling to identify compensatory pathways activated upon ubiA inhibition

    • Integration with transcriptomics to understand regulatory responses

These emerging technologies, especially when applied in combination, promise to provide unprecedented insights into ubiA function and facilitate the development of novel antimicrobials targeting this essential enzyme in drug-resistant Shigella strains.

What potential exists for developing selective inhibitors targeting Shigella dysenteriae ubiA?

The development of selective inhibitors targeting Shigella dysenteriae ubiA presents a promising antibiotic strategy with several favorable characteristics:

  • Structural Basis for Selectivity

    Detailed analysis of UbiA crystal structures reveals multiple opportunities for achieving selectivity:

    • Bacterial ubiA enzymes have distinct substrate binding pockets compared to human homologs

    • The lateral opening to the membrane represents a unique structural feature

    • Species-specific variations exist in non-catalytic regions that could be exploited

    These structural differences provide the foundation for designing compounds that specifically target bacterial ubiA while sparing human orthologs.

  • Chemical Scaffolds with Potential

    Several compound classes show promise as starting points for ubiA inhibitor development:

    • Prenyl diphosphate analogs that compete for the substrate binding site

    • 4-hydroxybenzoate derivatives with modifications preventing catalysis

    • Allosteric inhibitors targeting the lateral gate or domain interfaces

    • Covalent inhibitors targeting non-conserved cysteine residues

    • Lipophilic compounds that accumulate in bacterial membranes

  • Rational Design Strategies

    Multiple approaches can guide the development of selective ubiA inhibitors:

    Design StrategyTarget SitePotential Advantage
    Fragment-based screeningMultiple binding pocketsIdentification of diverse chemical starting points
    Structure-based designActive siteDirect interference with catalysis
    Transition state analogsCatalytic centerHigh-affinity binding
    Substrate mimeticsSubstrate binding sitesCompetitive inhibition
    Allosteric modulatorsProtein-protein interfacesDisruption of essential interactions
  • Delivery Considerations

    Effective inhibitors must reach their intracellular target:

    • Lipophilic compounds may passively diffuse across bacterial membranes

    • Prodrug approaches can enhance permeability

    • Nanoparticle formulations may improve delivery to infection sites

    • Targeting to the intestinal environment for Shigella infections

  • Combination Therapy Potential

    ubiA inhibitors could be particularly effective in combination with:

    • Conventional antibiotics against which resistance has emerged

    • Other metabolic inhibitors targeting complementary pathways

    • Host-directed therapies that enhance immune clearance

  • Resistance Management Strategies

    To minimize resistance development:

    • Dual-targeting inhibitors affecting multiple steps in ubiquinone biosynthesis

    • Compounds that bind to highly conserved regions less prone to mutation

    • Cocktails of inhibitors targeting different aspects of ubiA function

    • Cycling protocols to reduce selection pressure

  • Translational Pathway

    The development pipeline for ubiA inhibitors should include:

    • High-throughput screening assays using purified recombinant enzyme

    • Secondary cellular assays measuring ubiquinone levels

    • Tertiary infection models including cell culture and animal models

    • Pharmacokinetic optimization focusing on intestinal delivery

    • Safety assessment with particular attention to effects on human ubiquinone biosynthesis

The increasing prevalence of extensively drug-resistant Shigella strains heightens the importance of developing novel antimicrobials with distinct mechanisms of action. Selective inhibitors of ubiA represent a promising approach that targets an essential metabolic pathway while potentially circumventing existing resistance mechanisms.

How does current research on Shigella dysenteriae ubiA integrate with broader antimicrobial development strategies?

Research on Shigella dysenteriae 4-hydroxybenzoate octaprenyltransferase (ubiA) represents an important component within the broader landscape of antimicrobial development, particularly in addressing the growing challenge of extensively drug-resistant (XDR) Shigella infections . This integration occurs through several key connections:

  • Addressing Resistance Through Novel Targets

    The emergence of XDR Shigella strains with resistance to azithromycin, ciprofloxacin, ceftriaxone, trimethoprim-sulfamethoxazole, and ampicillin necessitates exploration of novel targets like ubiA that fall outside traditional antibiotic mechanisms. By targeting bacterial metabolism rather than conventional pathways, ubiA inhibitors could circumvent existing resistance mechanisms.

  • Contributing to Pathway-Based Antimicrobial Strategies

    Rather than focusing on isolated targets, modern antimicrobial development increasingly considers entire metabolic pathways. ubiA research contributes to understanding ubiquinone biosynthesis as an integrated system, including its connections with:

    • Aerobic and anaerobic respiratory chains

    • Oxidative stress responses

    • Membrane homeostasis

    • Energy production networks

    This systems-level understanding facilitates more robust therapeutic approaches that target multiple interdependent processes.

  • Leveraging Structural Biology Advances

    The determination of UbiA crystal structures exemplifies how structural biology drives modern antimicrobial discovery. These structural insights:

    • Enable structure-based drug design approaches

    • Inform rational selection of residues for mutagenesis

    • Facilitate virtual screening of compound libraries

    • Provide templates for homology modeling of related enzymes

    Similar approaches are being applied to numerous other bacterial targets, creating synergies across antimicrobial research programs.

  • Connecting with Vaccine Development

    Research on Shigella metabolism complements vaccine development efforts such as the Flexyn2a bioconjugate vaccine . Understanding metabolic requirements for bacterial survival provides:

    • Potential targets for attenuated live vaccines

    • Insights into bacterial adaptation during infection

    • Metabolic biomarkers for vaccine efficacy assessment

    • Targets for combination therapies (vaccines plus selective metabolic inhibitors)

  • Addressing Global Health Priorities

    Shigella dysenteriae research aligns with broader global health initiatives targeting enteric diseases, particularly in low and middle-income countries where shigellosis causes significant morbidity and mortality . ubiA research contributes to:

    • Expanding the antimicrobial pipeline for priority pathogens

    • Developing therapeutics suitable for resource-limited settings

    • Addressing antimicrobial resistance in enteric pathogens

    • Providing scientific foundations for public health interventions

The integration of ubiA research with these broader antimicrobial strategies creates a multifaceted approach to combating Shigella infections, particularly as drug resistance continues to emerge in this significant global pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.